Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317UWD8

Protein Details
Accession A0A317UWD8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-157EEEGSLRSRRPPRRRRREVVEEIFEBasic
NLS Segment(s)
PositionSequence
139-177RSRRPPRRRRREVVEEIFEARGGGRRGRRTRGTRPGGGG
Subcellular Location(s) extr 7cyto_nucl 7, nucl 6.5, cyto 4.5, mito 4, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPIPLPLRIRIPDLNTLLHLPSHLHQHENQNDSQPPLPSTTPDNNNNTNNNNHNHNNNNYTPLDLKRSAPVTIPSTYHTHGPSPGTVAGIVIGSVLGFLLLLYLIYLGLGAGRKFSSEASTVENMSEVVVEEEEGSLRSRRPPRRRRREVVEEIFEARGGGRRGRRTRGTRPGGGGSGGGGRIVVEESVTSPDRSDVVEVLEEHSSVEGPEAGRRRSRAGAYRRVDPEAFGGLTEDESLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.36
4 0.35
5 0.31
6 0.26
7 0.23
8 0.17
9 0.16
10 0.24
11 0.24
12 0.25
13 0.29
14 0.38
15 0.45
16 0.47
17 0.47
18 0.44
19 0.44
20 0.45
21 0.43
22 0.35
23 0.29
24 0.29
25 0.28
26 0.23
27 0.28
28 0.32
29 0.36
30 0.41
31 0.46
32 0.48
33 0.53
34 0.55
35 0.52
36 0.5
37 0.49
38 0.45
39 0.46
40 0.44
41 0.45
42 0.46
43 0.47
44 0.47
45 0.43
46 0.44
47 0.37
48 0.36
49 0.33
50 0.3
51 0.31
52 0.27
53 0.27
54 0.26
55 0.28
56 0.26
57 0.25
58 0.27
59 0.24
60 0.24
61 0.24
62 0.22
63 0.24
64 0.24
65 0.25
66 0.22
67 0.2
68 0.2
69 0.21
70 0.19
71 0.18
72 0.17
73 0.14
74 0.13
75 0.11
76 0.09
77 0.07
78 0.07
79 0.04
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.06
103 0.07
104 0.08
105 0.08
106 0.1
107 0.12
108 0.13
109 0.13
110 0.13
111 0.12
112 0.1
113 0.09
114 0.08
115 0.04
116 0.04
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.06
124 0.06
125 0.07
126 0.14
127 0.23
128 0.34
129 0.44
130 0.55
131 0.65
132 0.76
133 0.85
134 0.86
135 0.86
136 0.87
137 0.86
138 0.82
139 0.75
140 0.65
141 0.57
142 0.49
143 0.39
144 0.29
145 0.19
146 0.16
147 0.13
148 0.16
149 0.2
150 0.29
151 0.35
152 0.42
153 0.51
154 0.54
155 0.63
156 0.69
157 0.7
158 0.65
159 0.63
160 0.59
161 0.51
162 0.44
163 0.34
164 0.24
165 0.18
166 0.14
167 0.1
168 0.07
169 0.06
170 0.06
171 0.06
172 0.05
173 0.04
174 0.04
175 0.05
176 0.1
177 0.11
178 0.11
179 0.11
180 0.12
181 0.13
182 0.13
183 0.14
184 0.1
185 0.11
186 0.13
187 0.13
188 0.14
189 0.14
190 0.13
191 0.12
192 0.12
193 0.1
194 0.08
195 0.08
196 0.08
197 0.08
198 0.14
199 0.19
200 0.23
201 0.28
202 0.3
203 0.34
204 0.38
205 0.44
206 0.48
207 0.52
208 0.58
209 0.58
210 0.64
211 0.63
212 0.63
213 0.56
214 0.48
215 0.42
216 0.36
217 0.32
218 0.23
219 0.2
220 0.16
221 0.16
222 0.16