Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WTB4

Protein Details
Accession A0A317WTB4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
250-282DEPFKDSGRRHLRHTKRRRSHRSVDSYRPRDYRBasic
NLS Segment(s)
PositionSequence
256-271SGRRHLRHTKRRRSHR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPSHSIHLSKSFNRKVDELVQKYDRSNEPSPALRDFLRNADGLTSLMNAIRRHVLLVQSRSKDIEDAQITVYDSALLILSNHGDDPRDTGALELYLAEFLGIVPTSPGSLDRQKIDDHVSLESALTRATESGHTTDRTASADEEDKKPDHASMSRNEVSSFDDDRLRAQADRLIEVYRLAKSEYYGEKKRDGVDLLSLVRYLRDTAENTLLYLQANGMADHPLVSDIKYSFEMAKDKAAQLSGGRARHFDEPFKDSGRRHLRHTKRRRSHRSVDSYRPRDYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.57
4 0.6
5 0.54
6 0.54
7 0.54
8 0.53
9 0.53
10 0.54
11 0.49
12 0.46
13 0.45
14 0.42
15 0.42
16 0.46
17 0.47
18 0.43
19 0.41
20 0.35
21 0.35
22 0.33
23 0.32
24 0.29
25 0.25
26 0.23
27 0.21
28 0.2
29 0.17
30 0.15
31 0.11
32 0.09
33 0.1
34 0.14
35 0.13
36 0.15
37 0.17
38 0.17
39 0.17
40 0.19
41 0.23
42 0.27
43 0.33
44 0.39
45 0.39
46 0.4
47 0.4
48 0.38
49 0.33
50 0.27
51 0.28
52 0.22
53 0.21
54 0.2
55 0.2
56 0.2
57 0.19
58 0.18
59 0.1
60 0.08
61 0.07
62 0.06
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.1
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.04
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.05
95 0.08
96 0.13
97 0.15
98 0.16
99 0.18
100 0.19
101 0.2
102 0.23
103 0.22
104 0.19
105 0.17
106 0.16
107 0.15
108 0.14
109 0.13
110 0.09
111 0.06
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.07
118 0.09
119 0.12
120 0.12
121 0.13
122 0.13
123 0.13
124 0.13
125 0.12
126 0.1
127 0.1
128 0.14
129 0.16
130 0.17
131 0.18
132 0.18
133 0.18
134 0.18
135 0.17
136 0.15
137 0.16
138 0.17
139 0.18
140 0.25
141 0.26
142 0.26
143 0.25
144 0.24
145 0.23
146 0.23
147 0.21
148 0.15
149 0.15
150 0.15
151 0.16
152 0.17
153 0.16
154 0.12
155 0.12
156 0.13
157 0.12
158 0.13
159 0.13
160 0.13
161 0.11
162 0.12
163 0.13
164 0.12
165 0.11
166 0.11
167 0.1
168 0.1
169 0.15
170 0.21
171 0.26
172 0.32
173 0.34
174 0.36
175 0.38
176 0.38
177 0.36
178 0.31
179 0.24
180 0.21
181 0.21
182 0.19
183 0.17
184 0.16
185 0.13
186 0.12
187 0.12
188 0.1
189 0.09
190 0.11
191 0.12
192 0.15
193 0.2
194 0.2
195 0.2
196 0.2
197 0.19
198 0.16
199 0.14
200 0.11
201 0.08
202 0.09
203 0.09
204 0.09
205 0.09
206 0.09
207 0.09
208 0.09
209 0.08
210 0.08
211 0.08
212 0.1
213 0.1
214 0.12
215 0.13
216 0.14
217 0.14
218 0.17
219 0.21
220 0.19
221 0.24
222 0.25
223 0.25
224 0.25
225 0.25
226 0.23
227 0.2
228 0.27
229 0.27
230 0.28
231 0.28
232 0.28
233 0.3
234 0.36
235 0.38
236 0.36
237 0.35
238 0.36
239 0.39
240 0.42
241 0.45
242 0.39
243 0.47
244 0.52
245 0.49
246 0.53
247 0.6
248 0.66
249 0.72
250 0.82
251 0.83
252 0.83
253 0.92
254 0.94
255 0.93
256 0.92
257 0.92
258 0.92
259 0.9
260 0.9
261 0.9
262 0.85