Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WRK9

Protein Details
Accession A0A317WRK9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-171GMEQIPHPRRSERRKRGKKEEEKEKTKSREKEBasic
NLS Segment(s)
PositionSequence
147-171PRRSERRKRGKKEEEKEKTKSREKE
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MGPSHLITPSFSDSSALNLLPTSLPSCLFVARERSGPNPIGTPAAPSQASITGPAYPDTRRIASHRSMSSASRQISSLVAFGKPAVRYGVHPCLRHHASPQLPSTGNDNVAGNTQRQLRLGSFEPQTRSFLPEHKTFDEGMEQIPHPRRSERRKRGKKEEEKEKTKSREKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.18
4 0.13
5 0.12
6 0.13
7 0.12
8 0.13
9 0.11
10 0.1
11 0.1
12 0.12
13 0.13
14 0.13
15 0.14
16 0.16
17 0.21
18 0.22
19 0.25
20 0.26
21 0.27
22 0.31
23 0.32
24 0.3
25 0.25
26 0.24
27 0.23
28 0.21
29 0.22
30 0.18
31 0.19
32 0.18
33 0.16
34 0.16
35 0.15
36 0.16
37 0.14
38 0.13
39 0.11
40 0.12
41 0.13
42 0.14
43 0.12
44 0.16
45 0.17
46 0.18
47 0.18
48 0.21
49 0.24
50 0.27
51 0.33
52 0.31
53 0.31
54 0.31
55 0.3
56 0.32
57 0.33
58 0.29
59 0.23
60 0.23
61 0.21
62 0.2
63 0.19
64 0.15
65 0.1
66 0.09
67 0.08
68 0.08
69 0.1
70 0.09
71 0.1
72 0.09
73 0.09
74 0.11
75 0.16
76 0.25
77 0.27
78 0.29
79 0.29
80 0.35
81 0.38
82 0.36
83 0.33
84 0.31
85 0.3
86 0.33
87 0.33
88 0.3
89 0.28
90 0.28
91 0.29
92 0.24
93 0.22
94 0.18
95 0.17
96 0.13
97 0.15
98 0.15
99 0.12
100 0.14
101 0.16
102 0.16
103 0.16
104 0.18
105 0.16
106 0.19
107 0.21
108 0.23
109 0.24
110 0.27
111 0.3
112 0.3
113 0.33
114 0.29
115 0.3
116 0.27
117 0.29
118 0.3
119 0.32
120 0.36
121 0.35
122 0.36
123 0.33
124 0.33
125 0.31
126 0.26
127 0.22
128 0.2
129 0.18
130 0.24
131 0.31
132 0.33
133 0.32
134 0.4
135 0.47
136 0.55
137 0.66
138 0.7
139 0.74
140 0.82
141 0.9
142 0.93
143 0.95
144 0.95
145 0.94
146 0.94
147 0.94
148 0.91
149 0.89
150 0.88
151 0.86