Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317UKP4

Protein Details
Accession A0A317UKP4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
118-145AYRILLRYDRKSRHRRIKKQPSNFEGLKHydrophilic
NLS Segment(s)
PositionSequence
128-136KSRHRRIKK
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences WCVNTTNLAKDRADAQRLVATRLLDRLHDPLASPQGFLPGGRRQPAEVHGPKAYSYPTTTCGATSPRSGTDSDLEAFSHYPADGSVAALPGQTAAKTNYLNQRFLSSRSLLVGEQSNAYRILLRYDRKSRHRRIKKQPSNFEGLKGSIGHTFMVCIHTENQNQGDFYPFVLLEILFSMSPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.34
4 0.35
5 0.36
6 0.32
7 0.26
8 0.23
9 0.27
10 0.25
11 0.21
12 0.22
13 0.22
14 0.21
15 0.2
16 0.2
17 0.2
18 0.26
19 0.25
20 0.24
21 0.2
22 0.22
23 0.22
24 0.21
25 0.21
26 0.21
27 0.25
28 0.28
29 0.28
30 0.26
31 0.29
32 0.32
33 0.37
34 0.33
35 0.33
36 0.32
37 0.32
38 0.31
39 0.29
40 0.27
41 0.19
42 0.18
43 0.15
44 0.17
45 0.18
46 0.18
47 0.17
48 0.17
49 0.18
50 0.18
51 0.18
52 0.17
53 0.16
54 0.18
55 0.18
56 0.18
57 0.16
58 0.16
59 0.15
60 0.13
61 0.12
62 0.11
63 0.11
64 0.1
65 0.08
66 0.06
67 0.05
68 0.05
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.06
82 0.08
83 0.09
84 0.12
85 0.2
86 0.23
87 0.24
88 0.24
89 0.26
90 0.25
91 0.27
92 0.28
93 0.21
94 0.18
95 0.18
96 0.19
97 0.15
98 0.15
99 0.15
100 0.11
101 0.12
102 0.12
103 0.12
104 0.11
105 0.11
106 0.11
107 0.1
108 0.14
109 0.19
110 0.23
111 0.29
112 0.38
113 0.46
114 0.55
115 0.65
116 0.7
117 0.76
118 0.83
119 0.86
120 0.89
121 0.92
122 0.92
123 0.93
124 0.93
125 0.87
126 0.84
127 0.74
128 0.66
129 0.57
130 0.47
131 0.38
132 0.28
133 0.24
134 0.18
135 0.18
136 0.15
137 0.12
138 0.12
139 0.11
140 0.13
141 0.11
142 0.12
143 0.14
144 0.19
145 0.21
146 0.25
147 0.27
148 0.27
149 0.27
150 0.25
151 0.27
152 0.21
153 0.2
154 0.19
155 0.15
156 0.14
157 0.14
158 0.13
159 0.09
160 0.1
161 0.11