Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WE93

Protein Details
Accession A0A317WE93    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-69CGCLRLMQKCKPRAERRRQIRHEVQTLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, nucl 5, cyto_mito 5, extr 4, pero 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036661  Luciferase-like_sf  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MGDTPQDQPIRKQILLNAFDMCTMGHLSPGQWKASTPPTSPGCGCLRLMQKCKPRAERRRQIRHEVQTLLLDRTRQTARARGKDCGNSPGPPTPETDSYIDPTQVRLINHVGKYFTLHMRHIVDPSPQRTPFLFQAGTSAAGSAFAATHDDVIFFFATFTSVVGRADAEAQAKLAEARRHASVVGGLVLFSGWTGIDILGISLDRELGEESVGWVDDDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.45
4 0.38
5 0.31
6 0.3
7 0.27
8 0.21
9 0.13
10 0.12
11 0.1
12 0.1
13 0.1
14 0.11
15 0.18
16 0.21
17 0.21
18 0.2
19 0.2
20 0.23
21 0.31
22 0.35
23 0.3
24 0.35
25 0.36
26 0.4
27 0.4
28 0.4
29 0.35
30 0.32
31 0.31
32 0.3
33 0.35
34 0.39
35 0.45
36 0.48
37 0.54
38 0.59
39 0.67
40 0.71
41 0.74
42 0.77
43 0.82
44 0.84
45 0.87
46 0.9
47 0.88
48 0.88
49 0.86
50 0.83
51 0.77
52 0.68
53 0.59
54 0.52
55 0.48
56 0.4
57 0.31
58 0.24
59 0.19
60 0.22
61 0.21
62 0.21
63 0.21
64 0.27
65 0.34
66 0.42
67 0.45
68 0.44
69 0.48
70 0.49
71 0.49
72 0.47
73 0.41
74 0.33
75 0.33
76 0.34
77 0.31
78 0.26
79 0.27
80 0.24
81 0.23
82 0.24
83 0.24
84 0.2
85 0.21
86 0.21
87 0.2
88 0.17
89 0.16
90 0.16
91 0.16
92 0.15
93 0.14
94 0.17
95 0.2
96 0.2
97 0.21
98 0.18
99 0.16
100 0.17
101 0.17
102 0.18
103 0.16
104 0.15
105 0.18
106 0.2
107 0.21
108 0.21
109 0.2
110 0.21
111 0.23
112 0.26
113 0.28
114 0.25
115 0.26
116 0.26
117 0.28
118 0.25
119 0.25
120 0.23
121 0.17
122 0.19
123 0.18
124 0.19
125 0.14
126 0.12
127 0.08
128 0.08
129 0.08
130 0.06
131 0.05
132 0.04
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.08
141 0.06
142 0.06
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.1
155 0.1
156 0.09
157 0.09
158 0.09
159 0.09
160 0.11
161 0.14
162 0.15
163 0.16
164 0.19
165 0.2
166 0.21
167 0.21
168 0.2
169 0.16
170 0.14
171 0.14
172 0.11
173 0.09
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.03
180 0.03
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.05
190 0.06
191 0.05
192 0.06
193 0.07
194 0.07
195 0.08
196 0.07
197 0.09
198 0.1
199 0.1
200 0.09
201 0.08
202 0.08