Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317UJK7

Protein Details
Accession A0A317UJK7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-50YSFPRIFKGRRGRTGPRKGRQEEKRTLPRTRRRLRVQLRCRGBasic
NLS Segment(s)
PositionSequence
15-43FKGRRGRTGPRKGRQEEKRTLPRTRRRLR
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSTTWRENYSFPRIFKGRRGRTGPRKGRQEEKRTLPRTRRRLRVQLRCRGESTSRCRNINRLPFRHTAHEAPFKRNFPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.59
4 0.59
5 0.62
6 0.68
7 0.7
8 0.76
9 0.84
10 0.84
11 0.82
12 0.83
13 0.79
14 0.81
15 0.81
16 0.79
17 0.76
18 0.75
19 0.76
20 0.72
21 0.75
22 0.75
23 0.75
24 0.77
25 0.76
26 0.76
27 0.73
28 0.78
29 0.8
30 0.81
31 0.81
32 0.8
33 0.78
34 0.71
35 0.66
36 0.59
37 0.54
38 0.52
39 0.5
40 0.51
41 0.5
42 0.51
43 0.51
44 0.55
45 0.58
46 0.61
47 0.63
48 0.58
49 0.59
50 0.62
51 0.65
52 0.64
53 0.6
54 0.55
55 0.53
56 0.58
57 0.55
58 0.55
59 0.59
60 0.54