Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317W9W1

Protein Details
Accession A0A317W9W1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-171KDEYLRKKQKDERKAREEQRSREKLBasic
NLS Segment(s)
PositionSequence
151-176LRKKQKDERKAREEQRSREKLERRER
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYHFVSNVVEPPAIIYVGKDKFENEDLIKYGIERDVWFHVDNLSSAHVYLRLQENETWDNIPQQLLEDCAQLTKANSIEGNKKDNITVIYTPWSNLMKDGSMATGQVSFHNHKLVRKVYVHQRENPIVNRLNKTRVEKSPDLKAEKDEYLRKKQKDERKAREEQRSREKLERREREQLKWQKEHAYDDLMSEENIQASSNQDRDPDFLDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.16
5 0.19
6 0.21
7 0.2
8 0.19
9 0.23
10 0.26
11 0.3
12 0.24
13 0.25
14 0.25
15 0.26
16 0.25
17 0.21
18 0.2
19 0.17
20 0.16
21 0.13
22 0.14
23 0.16
24 0.19
25 0.2
26 0.18
27 0.18
28 0.17
29 0.17
30 0.16
31 0.14
32 0.11
33 0.1
34 0.11
35 0.11
36 0.1
37 0.13
38 0.18
39 0.17
40 0.19
41 0.21
42 0.25
43 0.25
44 0.27
45 0.25
46 0.19
47 0.19
48 0.18
49 0.17
50 0.12
51 0.11
52 0.1
53 0.11
54 0.12
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.11
65 0.13
66 0.2
67 0.22
68 0.26
69 0.24
70 0.25
71 0.24
72 0.24
73 0.23
74 0.19
75 0.17
76 0.13
77 0.15
78 0.15
79 0.15
80 0.16
81 0.16
82 0.12
83 0.12
84 0.12
85 0.09
86 0.1
87 0.1
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.1
96 0.11
97 0.12
98 0.17
99 0.18
100 0.19
101 0.24
102 0.25
103 0.27
104 0.27
105 0.31
106 0.37
107 0.45
108 0.48
109 0.47
110 0.51
111 0.49
112 0.51
113 0.49
114 0.44
115 0.4
116 0.4
117 0.4
118 0.37
119 0.39
120 0.4
121 0.44
122 0.45
123 0.44
124 0.48
125 0.49
126 0.5
127 0.53
128 0.55
129 0.53
130 0.47
131 0.45
132 0.41
133 0.39
134 0.4
135 0.4
136 0.4
137 0.47
138 0.54
139 0.54
140 0.59
141 0.64
142 0.69
143 0.72
144 0.77
145 0.76
146 0.77
147 0.84
148 0.84
149 0.86
150 0.85
151 0.83
152 0.83
153 0.79
154 0.76
155 0.75
156 0.75
157 0.74
158 0.76
159 0.77
160 0.73
161 0.76
162 0.75
163 0.73
164 0.76
165 0.76
166 0.74
167 0.71
168 0.68
169 0.66
170 0.64
171 0.63
172 0.55
173 0.5
174 0.41
175 0.36
176 0.34
177 0.26
178 0.23
179 0.19
180 0.17
181 0.12
182 0.11
183 0.11
184 0.09
185 0.12
186 0.17
187 0.19
188 0.19
189 0.21
190 0.23
191 0.25
192 0.28
193 0.29