Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317UTB3

Protein Details
Accession A0A317UTB3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRQPQQPKKREPLPTTFHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKKSSRQPQQPKK
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQQPKKREPLPTTFACLFCNHENSIVVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVAKDTATKHDENGARSRRSNDHNASPGTQDIGFDDTERVDAYVDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.89
4 0.88
5 0.82
6 0.79
7 0.75
8 0.67
9 0.64
10 0.58
11 0.5
12 0.42
13 0.37
14 0.34
15 0.29
16 0.3
17 0.24
18 0.22
19 0.23
20 0.23
21 0.24
22 0.22
23 0.2
24 0.19
25 0.19
26 0.21
27 0.2
28 0.19
29 0.17
30 0.17
31 0.19
32 0.18
33 0.21
34 0.23
35 0.23
36 0.22
37 0.21
38 0.22
39 0.19
40 0.23
41 0.23
42 0.23
43 0.25
44 0.27
45 0.29
46 0.29
47 0.29
48 0.23
49 0.2
50 0.14
51 0.12
52 0.1
53 0.08
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.09
71 0.1
72 0.14
73 0.14
74 0.15
75 0.15
76 0.21
77 0.25
78 0.27
79 0.35
80 0.39
81 0.39
82 0.41
83 0.46
84 0.45
85 0.48
86 0.54
87 0.51
88 0.52
89 0.54
90 0.54
91 0.51
92 0.47
93 0.41
94 0.34
95 0.28
96 0.2
97 0.16
98 0.15
99 0.13
100 0.12
101 0.13
102 0.11
103 0.12
104 0.12
105 0.1
106 0.09