Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317W1F5

Protein Details
Accession A0A317W1F5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-87DDSEDKAKEKKKHPGKRQPAKHKGRSADHRPEEBasic
NLS Segment(s)
PositionSequence
59-81DKAKEKKKHPGKRQPAKHKGRSA
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MNRIDNYNNMAKNISKEKGSRASDFKKKSITCFNCEKKNYIARDCRQKKKDQRSDDSEDKAKEKKKHPGKRQPAKHKGRSADHRPEEGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.31
4 0.36
5 0.44
6 0.46
7 0.45
8 0.47
9 0.53
10 0.58
11 0.6
12 0.58
13 0.57
14 0.54
15 0.54
16 0.57
17 0.53
18 0.49
19 0.54
20 0.57
21 0.57
22 0.58
23 0.55
24 0.5
25 0.53
26 0.52
27 0.49
28 0.5
29 0.47
30 0.57
31 0.62
32 0.66
33 0.64
34 0.69
35 0.72
36 0.75
37 0.79
38 0.77
39 0.77
40 0.75
41 0.78
42 0.74
43 0.69
44 0.63
45 0.56
46 0.5
47 0.48
48 0.48
49 0.48
50 0.49
51 0.54
52 0.6
53 0.69
54 0.77
55 0.82
56 0.86
57 0.89
58 0.93
59 0.94
60 0.94
61 0.93
62 0.92
63 0.89
64 0.86
65 0.85
66 0.85
67 0.83
68 0.83
69 0.79
70 0.74