Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VLX6

Protein Details
Accession A0A317VLX6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
28-53VPIHASRNKTKRKQNKTDPFRTPPKKHydrophilic
NLS Segment(s)
PositionSequence
38-40KRK
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MTSQNFSRSDSDNSFYVCLLPDVLFADVPIHASRNKTKRKQNKTDPFRTPPKKPHCCELEIRMLGQITSRPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.17
5 0.13
6 0.11
7 0.09
8 0.08
9 0.09
10 0.09
11 0.08
12 0.08
13 0.08
14 0.06
15 0.08
16 0.08
17 0.08
18 0.09
19 0.12
20 0.19
21 0.27
22 0.36
23 0.43
24 0.52
25 0.62
26 0.71
27 0.78
28 0.83
29 0.85
30 0.85
31 0.87
32 0.85
33 0.82
34 0.82
35 0.79
36 0.75
37 0.75
38 0.76
39 0.77
40 0.72
41 0.73
42 0.67
43 0.65
44 0.64
45 0.6
46 0.59
47 0.5
48 0.48
49 0.41
50 0.36
51 0.31
52 0.27
53 0.24