Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317V629

Protein Details
Accession A0A317V629   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLRRRRRRRRERRGMKRMRGWGNGEBasic
NLS Segment(s)
PositionSequence
3-19RRRRRRRRERRGMKRMR
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MLRRRRRRRRERRGMKRMRGWGNGEVIIAGACTGSASAPPVASTPHAFPTTAPTPRVGERLFPYPMHSRLRLFPSFPLHNRNGLPEASPSNELLLRTLSTTLDIPVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.95
3 0.93
4 0.91
5 0.87
6 0.82
7 0.75
8 0.68
9 0.6
10 0.51
11 0.41
12 0.31
13 0.23
14 0.17
15 0.12
16 0.08
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.08
30 0.1
31 0.1
32 0.13
33 0.13
34 0.13
35 0.13
36 0.19
37 0.22
38 0.23
39 0.22
40 0.2
41 0.21
42 0.22
43 0.26
44 0.2
45 0.18
46 0.18
47 0.22
48 0.23
49 0.21
50 0.24
51 0.25
52 0.3
53 0.31
54 0.3
55 0.28
56 0.3
57 0.37
58 0.34
59 0.31
60 0.3
61 0.33
62 0.38
63 0.39
64 0.41
65 0.37
66 0.4
67 0.39
68 0.39
69 0.34
70 0.29
71 0.27
72 0.23
73 0.24
74 0.22
75 0.23
76 0.2
77 0.19
78 0.21
79 0.19
80 0.18
81 0.17
82 0.14
83 0.14
84 0.15
85 0.13
86 0.13
87 0.13