Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1CGT6

Protein Details
Accession A0A0D1CGT6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-125YQPSQRIRKRRHGFLSRIKTRNGRKTIMRRRFRGKAKLSHBasic
NLS Segment(s)
PositionSequence
91-125RIRKRRHGFLSRIKTRNGRKTIMRRRFRGKAKLSH
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG uma:UMAG_11801  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLSPFRPLLRLASSCAARATTPLASSVLSRFASTRSCSITRISPITPRICTLLAQPRTTVLSLLPASAAPSIAPVRCVTYGSEYQPSQRIRKRRHGFLSRIKTRNGRKTIMRRRFRGKAKLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.32
4 0.31
5 0.27
6 0.21
7 0.2
8 0.2
9 0.15
10 0.14
11 0.14
12 0.14
13 0.13
14 0.14
15 0.14
16 0.15
17 0.14
18 0.14
19 0.13
20 0.14
21 0.18
22 0.19
23 0.2
24 0.21
25 0.22
26 0.23
27 0.25
28 0.27
29 0.27
30 0.28
31 0.26
32 0.26
33 0.3
34 0.32
35 0.31
36 0.28
37 0.26
38 0.24
39 0.23
40 0.22
41 0.27
42 0.27
43 0.26
44 0.26
45 0.24
46 0.25
47 0.25
48 0.2
49 0.1
50 0.11
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.04
59 0.06
60 0.07
61 0.07
62 0.08
63 0.08
64 0.1
65 0.11
66 0.12
67 0.11
68 0.14
69 0.17
70 0.19
71 0.23
72 0.21
73 0.23
74 0.29
75 0.32
76 0.36
77 0.4
78 0.47
79 0.5
80 0.61
81 0.67
82 0.7
83 0.76
84 0.77
85 0.8
86 0.81
87 0.84
88 0.83
89 0.79
90 0.74
91 0.73
92 0.74
93 0.75
94 0.7
95 0.65
96 0.65
97 0.73
98 0.79
99 0.81
100 0.81
101 0.78
102 0.81
103 0.85
104 0.85
105 0.84