Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N1X4

Protein Details
Accession A8N1X4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-114QMWTETPKGKNKKPVNKDRFISKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR027248  Sm_D2  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005829  C:cytosol  
GO:0030532  C:small nuclear ribonucleoprotein complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
GO:0006364  P:rRNA processing  
KEGG cci:CC1G_03667  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01720  Sm_D2  
Amino Acid Sequences MSQYVHVPKSELDEAQLRQLEEHEISQGPLSVLQQAVRNHAQVLISLRNNKKLLARVKAFDRHSNMVLENVKEERPSPFTTIQEPRLMVNSQMWTETPKGKNKKPVNKDRFISKMFLRGDSVILVLRNQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.33
4 0.27
5 0.24
6 0.25
7 0.25
8 0.21
9 0.2
10 0.16
11 0.14
12 0.14
13 0.14
14 0.14
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.11
21 0.16
22 0.16
23 0.21
24 0.21
25 0.21
26 0.2
27 0.21
28 0.19
29 0.16
30 0.19
31 0.19
32 0.2
33 0.27
34 0.28
35 0.33
36 0.34
37 0.33
38 0.33
39 0.35
40 0.38
41 0.38
42 0.39
43 0.36
44 0.4
45 0.46
46 0.45
47 0.43
48 0.41
49 0.36
50 0.34
51 0.33
52 0.28
53 0.25
54 0.23
55 0.19
56 0.16
57 0.14
58 0.14
59 0.13
60 0.13
61 0.12
62 0.14
63 0.16
64 0.19
65 0.21
66 0.22
67 0.28
68 0.32
69 0.32
70 0.31
71 0.3
72 0.26
73 0.26
74 0.25
75 0.2
76 0.19
77 0.18
78 0.15
79 0.16
80 0.15
81 0.15
82 0.17
83 0.24
84 0.26
85 0.34
86 0.42
87 0.47
88 0.57
89 0.65
90 0.73
91 0.76
92 0.82
93 0.82
94 0.82
95 0.8
96 0.78
97 0.75
98 0.67
99 0.62
100 0.52
101 0.51
102 0.44
103 0.43
104 0.37
105 0.31
106 0.29
107 0.25
108 0.24
109 0.18
110 0.16