Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317UM02

Protein Details
Accession A0A317UM02    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-145NAYRILLRYDRKSRHRRIKKQPSNFEGLKHydrophilic
NLS Segment(s)
PositionSequence
127-136RKSRHRRIKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences WCVNTTNLAKDRADAQRLVATRLLDRLHDPLASPQGFLPGGRRQPAEVHGPKAYSYPTTTCGATSPRSGTDSDLEAFSHYPADGSVAALPGQTAAKTNYLNQRFLSSRSLLVGEQSNAYRILLRYDRKSRHRRIKKQPSNFEGLKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.33
4 0.34
5 0.35
6 0.31
7 0.25
8 0.23
9 0.26
10 0.24
11 0.2
12 0.21
13 0.21
14 0.2
15 0.19
16 0.19
17 0.19
18 0.25
19 0.24
20 0.22
21 0.19
22 0.21
23 0.21
24 0.2
25 0.2
26 0.2
27 0.23
28 0.26
29 0.26
30 0.24
31 0.26
32 0.29
33 0.35
34 0.31
35 0.31
36 0.3
37 0.3
38 0.29
39 0.27
40 0.25
41 0.17
42 0.16
43 0.14
44 0.15
45 0.16
46 0.16
47 0.15
48 0.16
49 0.17
50 0.16
51 0.16
52 0.15
53 0.14
54 0.16
55 0.16
56 0.15
57 0.14
58 0.14
59 0.13
60 0.12
61 0.11
62 0.1
63 0.1
64 0.09
65 0.07
66 0.06
67 0.05
68 0.05
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.1
83 0.11
84 0.15
85 0.23
86 0.26
87 0.28
88 0.27
89 0.31
90 0.3
91 0.32
92 0.32
93 0.25
94 0.22
95 0.22
96 0.23
97 0.18
98 0.19
99 0.18
100 0.15
101 0.16
102 0.15
103 0.15
104 0.14
105 0.15
106 0.15
107 0.13
108 0.18
109 0.23
110 0.28
111 0.36
112 0.45
113 0.54
114 0.62
115 0.72
116 0.77
117 0.81
118 0.87
119 0.89
120 0.91
121 0.94
122 0.94
123 0.95
124 0.95
125 0.9
126 0.87
127 0.78