Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WUM5

Protein Details
Accession A0A317WUM5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-134ADTSSSAKKKKPTTKGKKKVVKPESDDDHydrophilic
NLS Segment(s)
PositionSequence
90-99GAKGGKANLK
113-127AKKKKPTTKGKKKVV
Subcellular Location(s) cyto 14, cyto_nucl 11.833, nucl 7.5, mito_nucl 5.666, mito 2.5
Family & Domain DBs
Amino Acid Sequences MPPKLAVPDTNTLFLYVCLLKSDFTSVDWKAVTAATDLNENAARMRFSRLKKRLEAFVGADGKVDVKRGEPAAESSAASTPASTPVKKQGAKGGKANLKRPGDDDAADTSSSAKKKKPTTKGKKKVVKPESDDDETVDLSDHGSASQDNDDASVKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.16
4 0.14
5 0.13
6 0.14
7 0.13
8 0.14
9 0.17
10 0.13
11 0.14
12 0.19
13 0.17
14 0.2
15 0.19
16 0.18
17 0.16
18 0.16
19 0.15
20 0.11
21 0.11
22 0.09
23 0.11
24 0.1
25 0.12
26 0.12
27 0.11
28 0.12
29 0.12
30 0.12
31 0.11
32 0.18
33 0.22
34 0.28
35 0.39
36 0.45
37 0.5
38 0.56
39 0.58
40 0.58
41 0.54
42 0.51
43 0.41
44 0.4
45 0.36
46 0.29
47 0.26
48 0.2
49 0.18
50 0.15
51 0.15
52 0.08
53 0.07
54 0.09
55 0.1
56 0.1
57 0.1
58 0.11
59 0.12
60 0.12
61 0.12
62 0.1
63 0.1
64 0.1
65 0.09
66 0.08
67 0.06
68 0.11
69 0.13
70 0.13
71 0.13
72 0.2
73 0.27
74 0.29
75 0.3
76 0.33
77 0.39
78 0.42
79 0.45
80 0.45
81 0.44
82 0.48
83 0.52
84 0.52
85 0.46
86 0.43
87 0.41
88 0.38
89 0.34
90 0.3
91 0.27
92 0.21
93 0.21
94 0.2
95 0.18
96 0.15
97 0.17
98 0.19
99 0.2
100 0.21
101 0.27
102 0.37
103 0.47
104 0.56
105 0.63
106 0.72
107 0.81
108 0.87
109 0.91
110 0.91
111 0.9
112 0.9
113 0.88
114 0.86
115 0.81
116 0.79
117 0.76
118 0.71
119 0.63
120 0.53
121 0.46
122 0.36
123 0.3
124 0.22
125 0.14
126 0.1
127 0.1
128 0.08
129 0.06
130 0.07
131 0.07
132 0.09
133 0.11
134 0.11
135 0.1
136 0.12
137 0.14