Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X231

Protein Details
Accession A0A317X231    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-69TIPTTTTTTTRRRRRRRRRRNNRHGNNLRPKPQLHydrophilic
NLS Segment(s)
PositionSequence
46-69RRRRRRRRRRNNRHGNNLRPKPQL
Subcellular Location(s) mito 14, extr 8, nucl 3
Family & Domain DBs
Amino Acid Sequences PNSPIRFNTLLPHNLSYRLQSTSPSLLCFLPTNSTTIPTTTTTTTRRRRRRRRRRNNRHGNNLRPKPQLPLPPSYRPPHHPRPILIHAIRGNKQHPVPLGWVWVWVGDVDPGGGDGGGRWCWCWCLLFRHGDGDGDEDGEKQELTGMMYHCVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.35
4 0.3
5 0.29
6 0.25
7 0.24
8 0.26
9 0.29
10 0.29
11 0.26
12 0.25
13 0.22
14 0.23
15 0.22
16 0.19
17 0.18
18 0.17
19 0.19
20 0.17
21 0.2
22 0.19
23 0.18
24 0.19
25 0.17
26 0.19
27 0.18
28 0.22
29 0.25
30 0.34
31 0.43
32 0.51
33 0.6
34 0.69
35 0.79
36 0.86
37 0.92
38 0.94
39 0.95
40 0.97
41 0.97
42 0.98
43 0.98
44 0.96
45 0.96
46 0.94
47 0.92
48 0.92
49 0.87
50 0.82
51 0.75
52 0.65
53 0.58
54 0.54
55 0.51
56 0.44
57 0.44
58 0.43
59 0.45
60 0.49
61 0.49
62 0.46
63 0.45
64 0.49
65 0.51
66 0.53
67 0.5
68 0.47
69 0.51
70 0.53
71 0.54
72 0.46
73 0.41
74 0.38
75 0.4
76 0.41
77 0.36
78 0.33
79 0.3
80 0.3
81 0.28
82 0.25
83 0.22
84 0.22
85 0.2
86 0.21
87 0.17
88 0.17
89 0.14
90 0.13
91 0.11
92 0.08
93 0.07
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.04
103 0.06
104 0.07
105 0.07
106 0.08
107 0.08
108 0.1
109 0.11
110 0.13
111 0.14
112 0.19
113 0.24
114 0.29
115 0.29
116 0.32
117 0.32
118 0.32
119 0.29
120 0.26
121 0.21
122 0.18
123 0.17
124 0.13
125 0.13
126 0.12
127 0.11
128 0.08
129 0.1
130 0.09
131 0.1
132 0.13
133 0.14