Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WMF2

Protein Details
Accession A0A317WMF2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-140TPQQTPTQSRKRGRPKKVNSSEKASDHydrophilic
NLS Segment(s)
PositionSequence
88-97KKRGRPPKNP
124-131RKRGRPKK
Subcellular Location(s) cyto 15, nucl 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MPMSWNETADAKLLIGILHTSSVKLDFAALAQYMGPDCTVSAVQHRIQRLKDKVSAGAGTDSASGTPVKKAGAKNAGAGTESAVSTTKKRGRPPKNPAPGPEGASPEAGGVGTGTPQQTPTQSRKRGRPKKVNSSEKASDDNSASASASASASSNNVKFEMDVDAEMNVDNEDSYVDIGADDQKDDDMKVKIEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.09
6 0.09
7 0.09
8 0.09
9 0.11
10 0.1
11 0.1
12 0.1
13 0.08
14 0.08
15 0.1
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.06
24 0.05
25 0.07
26 0.08
27 0.08
28 0.12
29 0.16
30 0.2
31 0.23
32 0.28
33 0.32
34 0.35
35 0.43
36 0.44
37 0.45
38 0.47
39 0.45
40 0.43
41 0.4
42 0.37
43 0.29
44 0.25
45 0.19
46 0.15
47 0.13
48 0.11
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.08
55 0.09
56 0.13
57 0.14
58 0.2
59 0.25
60 0.26
61 0.28
62 0.28
63 0.27
64 0.23
65 0.22
66 0.17
67 0.11
68 0.1
69 0.08
70 0.08
71 0.08
72 0.09
73 0.16
74 0.22
75 0.25
76 0.33
77 0.43
78 0.52
79 0.62
80 0.7
81 0.74
82 0.77
83 0.75
84 0.71
85 0.66
86 0.58
87 0.51
88 0.44
89 0.36
90 0.26
91 0.24
92 0.21
93 0.15
94 0.13
95 0.09
96 0.06
97 0.04
98 0.03
99 0.03
100 0.04
101 0.05
102 0.05
103 0.06
104 0.07
105 0.1
106 0.15
107 0.23
108 0.31
109 0.4
110 0.46
111 0.55
112 0.66
113 0.73
114 0.8
115 0.82
116 0.83
117 0.85
118 0.9
119 0.9
120 0.83
121 0.81
122 0.76
123 0.67
124 0.61
125 0.51
126 0.42
127 0.33
128 0.29
129 0.22
130 0.17
131 0.15
132 0.11
133 0.1
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.08
140 0.12
141 0.13
142 0.13
143 0.14
144 0.14
145 0.13
146 0.14
147 0.16
148 0.13
149 0.13
150 0.12
151 0.11
152 0.11
153 0.11
154 0.11
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.1
167 0.1
168 0.1
169 0.11
170 0.12
171 0.13
172 0.14
173 0.17
174 0.16