Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WI65

Protein Details
Accession A0A317WI65    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-39PGNNKEGKEKEKGKKKKKTKTKTEMELQLDBasic
NLS Segment(s)
PositionSequence
14-30KEGKEKEKGKKKKKTKT
Subcellular Location(s) nucl 13, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
IPR015242  Ydc2_cat  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF09159  Ydc2-catalyt  
Amino Acid Sequences MSGAVGVTTPGNNKEGKEKEKGKKKKKTKTKTEMELQLDEEQGERERAGELDIGKLDDLADCLLQGVTWVEWQAMRERVCREQRACLDYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.35
4 0.42
5 0.5
6 0.57
7 0.67
8 0.77
9 0.78
10 0.81
11 0.88
12 0.89
13 0.9
14 0.91
15 0.92
16 0.92
17 0.9
18 0.87
19 0.85
20 0.82
21 0.74
22 0.65
23 0.56
24 0.46
25 0.37
26 0.29
27 0.21
28 0.14
29 0.11
30 0.1
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.07
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.13
61 0.18
62 0.2
63 0.24
64 0.28
65 0.37
66 0.45
67 0.52
68 0.5
69 0.54
70 0.59