Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317X232

Protein Details
Accession A0A317X232    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-47DGEGGGEKKKRREERRERKLKGRGGKGRRRGKABasic
NLS Segment(s)
PositionSequence
19-71GGEKKKRREERRERKLKGRGGKGRRRGKAQEWWGREKIASGSKKKRAPQKAKV
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGWWGEREKEMKLEDGEGGGEKKKRREERRERKLKGRGGKGRRRGKAQEWWGREKIASGSKKKRAPQKAKVPASFAVRVTGRWPHRGPWTTSELLSGPPARGKSVLVTPRVSSLLLTPPASSRPPILRQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.17
5 0.18
6 0.18
7 0.21
8 0.24
9 0.3
10 0.39
11 0.49
12 0.57
13 0.67
14 0.74
15 0.81
16 0.88
17 0.92
18 0.89
19 0.88
20 0.87
21 0.84
22 0.82
23 0.81
24 0.79
25 0.79
26 0.82
27 0.82
28 0.83
29 0.8
30 0.78
31 0.73
32 0.69
33 0.69
34 0.69
35 0.68
36 0.63
37 0.65
38 0.59
39 0.53
40 0.47
41 0.38
42 0.32
43 0.31
44 0.31
45 0.33
46 0.39
47 0.46
48 0.52
49 0.55
50 0.61
51 0.64
52 0.67
53 0.69
54 0.72
55 0.75
56 0.77
57 0.73
58 0.67
59 0.6
60 0.55
61 0.48
62 0.37
63 0.3
64 0.23
65 0.22
66 0.21
67 0.25
68 0.23
69 0.27
70 0.28
71 0.28
72 0.37
73 0.41
74 0.42
75 0.39
76 0.43
77 0.38
78 0.37
79 0.35
80 0.27
81 0.24
82 0.23
83 0.19
84 0.14
85 0.16
86 0.16
87 0.16
88 0.16
89 0.16
90 0.16
91 0.23
92 0.28
93 0.28
94 0.3
95 0.29
96 0.31
97 0.32
98 0.29
99 0.21
100 0.18
101 0.21
102 0.23
103 0.23
104 0.21
105 0.22
106 0.25
107 0.27
108 0.26
109 0.25
110 0.28