Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317V8B4

Protein Details
Accession A0A317V8B4    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-44EGVRGKGGKNRNEKRREEKKERKKTIIQHQHQBasic
109-134HVFTQLSSEKNRKKRRPNSSKATSAHHydrophilic
NLS Segment(s)
PositionSequence
4-36GRGEEKKRNEGVRGKGGKNRNEKRREEKKERKK
118-126KNRKKRRPN
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEKGRGEEKKRNEGVRGKGGKNRNEKRREEKKERKKTIIQHQHQHTPLIHHVFTHKAVVSEKQKKETKTIQHQHTPLIHHVFTHKAVVSEKQKKETKTIQHQHTPLIHHVFTQLSSEKNRKKRRPNSSKATSAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.69
4 0.62
5 0.63
6 0.67
7 0.67
8 0.7
9 0.73
10 0.72
11 0.74
12 0.78
13 0.81
14 0.84
15 0.86
16 0.86
17 0.88
18 0.89
19 0.91
20 0.91
21 0.88
22 0.84
23 0.83
24 0.83
25 0.83
26 0.79
27 0.77
28 0.75
29 0.75
30 0.68
31 0.62
32 0.52
33 0.45
34 0.42
35 0.37
36 0.31
37 0.24
38 0.24
39 0.23
40 0.23
41 0.21
42 0.16
43 0.13
44 0.14
45 0.19
46 0.27
47 0.34
48 0.35
49 0.41
50 0.45
51 0.45
52 0.5
53 0.51
54 0.5
55 0.51
56 0.58
57 0.56
58 0.58
59 0.58
60 0.56
61 0.52
62 0.46
63 0.39
64 0.35
65 0.29
66 0.23
67 0.24
68 0.22
69 0.2
70 0.2
71 0.16
72 0.13
73 0.14
74 0.19
75 0.27
76 0.34
77 0.35
78 0.41
79 0.45
80 0.45
81 0.5
82 0.51
83 0.5
84 0.51
85 0.58
86 0.56
87 0.58
88 0.58
89 0.56
90 0.52
91 0.46
92 0.39
93 0.35
94 0.29
95 0.23
96 0.24
97 0.21
98 0.19
99 0.2
100 0.19
101 0.18
102 0.25
103 0.34
104 0.41
105 0.51
106 0.62
107 0.68
108 0.77
109 0.84
110 0.89
111 0.9
112 0.92
113 0.92
114 0.9