Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X392

Protein Details
Accession A0A317X392    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
152-182QINIPPLPRHNRRHSRQRPRLHPPRCPNRLLHydrophilic
NLS Segment(s)
PositionSequence
163-169RRHSRQR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MTCPDLDSRFSTLDSRLLTLDSSLSVWTLEVSPILSAQSHGGPLRASEYGVSRERAVRSRHSHPHNHHHHHHQSLSLTLNINHSRRRRTLILILILIFNFNLNSNSNQHINLAHQHRAPNLLHNPHHNFLHDHVPDNPKHNPHHPDQYQYHQINIPPLPRHNRRHSRQRPRLHPPRCPNRLLDPPIPKATTTAPSPIHPAALARTNQGLFFAFAFAFAGGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.2
4 0.19
5 0.18
6 0.16
7 0.15
8 0.11
9 0.1
10 0.09
11 0.08
12 0.08
13 0.07
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.07
23 0.07
24 0.09
25 0.09
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.14
32 0.13
33 0.12
34 0.11
35 0.13
36 0.18
37 0.2
38 0.21
39 0.2
40 0.24
41 0.27
42 0.32
43 0.33
44 0.37
45 0.4
46 0.47
47 0.55
48 0.58
49 0.64
50 0.65
51 0.72
52 0.73
53 0.75
54 0.72
55 0.73
56 0.73
57 0.68
58 0.62
59 0.54
60 0.44
61 0.39
62 0.34
63 0.27
64 0.21
65 0.17
66 0.22
67 0.24
68 0.25
69 0.29
70 0.32
71 0.35
72 0.37
73 0.41
74 0.38
75 0.38
76 0.41
77 0.39
78 0.37
79 0.33
80 0.31
81 0.25
82 0.23
83 0.18
84 0.12
85 0.07
86 0.05
87 0.05
88 0.06
89 0.06
90 0.08
91 0.1
92 0.13
93 0.14
94 0.14
95 0.14
96 0.13
97 0.13
98 0.18
99 0.19
100 0.19
101 0.2
102 0.21
103 0.21
104 0.24
105 0.23
106 0.24
107 0.25
108 0.28
109 0.28
110 0.34
111 0.38
112 0.36
113 0.36
114 0.31
115 0.27
116 0.24
117 0.31
118 0.26
119 0.23
120 0.25
121 0.29
122 0.3
123 0.33
124 0.34
125 0.3
126 0.33
127 0.38
128 0.39
129 0.39
130 0.48
131 0.45
132 0.49
133 0.48
134 0.51
135 0.53
136 0.49
137 0.46
138 0.38
139 0.37
140 0.35
141 0.34
142 0.32
143 0.26
144 0.31
145 0.38
146 0.44
147 0.52
148 0.58
149 0.66
150 0.69
151 0.78
152 0.83
153 0.86
154 0.87
155 0.89
156 0.88
157 0.89
158 0.91
159 0.87
160 0.87
161 0.86
162 0.87
163 0.83
164 0.76
165 0.7
166 0.67
167 0.69
168 0.66
169 0.63
170 0.6
171 0.59
172 0.62
173 0.58
174 0.5
175 0.43
176 0.39
177 0.35
178 0.3
179 0.31
180 0.27
181 0.28
182 0.33
183 0.31
184 0.29
185 0.25
186 0.24
187 0.21
188 0.26
189 0.25
190 0.22
191 0.26
192 0.25
193 0.25
194 0.25
195 0.22
196 0.17
197 0.16
198 0.15
199 0.11
200 0.11
201 0.12
202 0.1