Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317X2R3

Protein Details
Accession A0A317X2R3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-90EEGVLTTRTQHRRRRRRRSPGFYYVEKPHydrophilic
NLS Segment(s)
PositionSequence
73-82HRRRRRRRSP
Subcellular Location(s) mito 9, plas 5, extr 5, mito_nucl 5, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPVPVPMSVSSLRTRDEPSSVGGGGGCPSTISGGGIAGIVLGTIAGTLLLLWLFRLCTMPREEGVLTTRTQHRRRRRRRSPGFYYVEKPRGEVRRPAKVYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.26
4 0.27
5 0.25
6 0.24
7 0.24
8 0.22
9 0.2
10 0.16
11 0.14
12 0.12
13 0.11
14 0.08
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.04
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.01
33 0.01
34 0.01
35 0.01
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.05
44 0.05
45 0.09
46 0.12
47 0.13
48 0.13
49 0.16
50 0.16
51 0.16
52 0.18
53 0.17
54 0.14
55 0.17
56 0.24
57 0.31
58 0.39
59 0.47
60 0.56
61 0.65
62 0.76
63 0.84
64 0.87
65 0.9
66 0.93
67 0.94
68 0.92
69 0.91
70 0.87
71 0.81
72 0.76
73 0.73
74 0.69
75 0.59
76 0.52
77 0.5
78 0.51
79 0.51
80 0.54
81 0.53
82 0.57
83 0.6