Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317V4T0

Protein Details
Accession A0A317V4T0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-63KPPPRPPPLQLRKNKKPKLSBasic
NLS Segment(s)
PositionSequence
44-61KPPPRPPPLQLRKNKKPK
Subcellular Location(s) extr 12, plas 8, mito 2, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MHTLFVAFAALLLLLLLLLLSKADFDDHLAWFVSVSLPSPMAPKPPPRPPPLQLRKNKKPKLSGPAVEKVCLSVSVIITDTTGLNSEDRCSFLSSSVLRPLQIHRIIGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.04
11 0.04
12 0.08
13 0.1
14 0.11
15 0.12
16 0.12
17 0.12
18 0.11
19 0.11
20 0.09
21 0.07
22 0.07
23 0.06
24 0.07
25 0.07
26 0.09
27 0.09
28 0.13
29 0.16
30 0.23
31 0.29
32 0.37
33 0.43
34 0.47
35 0.52
36 0.52
37 0.6
38 0.63
39 0.66
40 0.65
41 0.69
42 0.75
43 0.8
44 0.82
45 0.76
46 0.74
47 0.71
48 0.7
49 0.68
50 0.63
51 0.58
52 0.6
53 0.55
54 0.48
55 0.41
56 0.33
57 0.26
58 0.21
59 0.16
60 0.09
61 0.09
62 0.09
63 0.1
64 0.09
65 0.08
66 0.09
67 0.08
68 0.07
69 0.08
70 0.07
71 0.08
72 0.08
73 0.1
74 0.11
75 0.12
76 0.14
77 0.15
78 0.15
79 0.16
80 0.21
81 0.21
82 0.23
83 0.29
84 0.28
85 0.27
86 0.28
87 0.31
88 0.34
89 0.36
90 0.35