Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317URN6

Protein Details
Accession A0A317URN6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-114GTRAPSNKSGRIQKRHRKSRSSIVFRPNHydrophilic
NLS Segment(s)
PositionSequence
86-124KGTRAPSNKSGRIQKRHRKSRSSIVFRPNQTKARASKRK
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVSKRNKAKLRATVFGPVVDARTERLSAKLQELASQPKPNEEKSDMELDTTRTNGHGDNVNENAPSSNEDMDIDRGSGKGTRAPSNKSGRIQKRHRKSRSSIVFRPNQTKARASKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.78
4 0.74
5 0.68
6 0.64
7 0.61
8 0.54
9 0.46
10 0.39
11 0.29
12 0.23
13 0.2
14 0.17
15 0.12
16 0.13
17 0.14
18 0.13
19 0.16
20 0.18
21 0.19
22 0.21
23 0.23
24 0.22
25 0.24
26 0.26
27 0.3
28 0.3
29 0.33
30 0.31
31 0.33
32 0.35
33 0.33
34 0.35
35 0.31
36 0.29
37 0.28
38 0.32
39 0.26
40 0.24
41 0.23
42 0.2
43 0.18
44 0.16
45 0.13
46 0.09
47 0.1
48 0.09
49 0.09
50 0.12
51 0.12
52 0.15
53 0.16
54 0.16
55 0.15
56 0.15
57 0.14
58 0.1
59 0.11
60 0.1
61 0.08
62 0.08
63 0.09
64 0.1
65 0.11
66 0.11
67 0.1
68 0.09
69 0.08
70 0.09
71 0.1
72 0.1
73 0.12
74 0.16
75 0.23
76 0.27
77 0.32
78 0.39
79 0.46
80 0.52
81 0.54
82 0.61
83 0.63
84 0.7
85 0.76
86 0.78
87 0.81
88 0.86
89 0.88
90 0.86
91 0.84
92 0.84
93 0.85
94 0.83
95 0.8
96 0.79
97 0.79
98 0.76
99 0.77
100 0.74
101 0.69
102 0.64
103 0.63
104 0.63