Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WXL9

Protein Details
Accession A0A317WXL9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-47HDPANQIKSDQKKPRARQRQRRRQEPLTPFRFFHydrophilic
NLS Segment(s)
PositionSequence
26-37KKPRARQRQRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MSSSLSAALEKIHLHDPANQIKSDQKKPRARQRQRRRQEPLTPFRFFDLPGEIRLRIYGYVLFTPRRRQTTRFTGSVGASSKRNPFISPTSHRLALFLTSKRMHEEASDHFFSMQTFRLFPLQDYSRMPTIRAIAPTYRRSIAAIELILGSSWTAPPASWTVDRSLGLEDMVRVRTFKLFIEVDPSHPVFEGFRVSEGFYTDFAGELLQKVLAAVPALEFVEFDGWPSVRKSGALMKRLLQEVRAAGKKIAWGPERGWTDYDGEEDCDDPHGLREQEERMKQHQLERERREQREREWARVQAASLPLPLPLPQAQALPWLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.32
4 0.39
5 0.42
6 0.38
7 0.36
8 0.42
9 0.49
10 0.53
11 0.56
12 0.57
13 0.65
14 0.74
15 0.84
16 0.88
17 0.91
18 0.92
19 0.94
20 0.94
21 0.95
22 0.95
23 0.94
24 0.92
25 0.91
26 0.9
27 0.89
28 0.86
29 0.78
30 0.69
31 0.62
32 0.54
33 0.44
34 0.36
35 0.32
36 0.26
37 0.27
38 0.29
39 0.26
40 0.25
41 0.25
42 0.24
43 0.16
44 0.16
45 0.14
46 0.14
47 0.17
48 0.2
49 0.25
50 0.26
51 0.35
52 0.41
53 0.46
54 0.48
55 0.49
56 0.54
57 0.6
58 0.63
59 0.57
60 0.52
61 0.48
62 0.44
63 0.44
64 0.38
65 0.3
66 0.25
67 0.26
68 0.29
69 0.29
70 0.3
71 0.26
72 0.28
73 0.3
74 0.37
75 0.4
76 0.41
77 0.41
78 0.42
79 0.41
80 0.37
81 0.33
82 0.29
83 0.28
84 0.24
85 0.26
86 0.25
87 0.25
88 0.28
89 0.28
90 0.24
91 0.2
92 0.22
93 0.21
94 0.26
95 0.26
96 0.23
97 0.22
98 0.22
99 0.21
100 0.19
101 0.18
102 0.12
103 0.11
104 0.12
105 0.15
106 0.15
107 0.16
108 0.2
109 0.19
110 0.2
111 0.22
112 0.24
113 0.26
114 0.25
115 0.26
116 0.21
117 0.22
118 0.22
119 0.21
120 0.2
121 0.2
122 0.25
123 0.27
124 0.28
125 0.26
126 0.23
127 0.22
128 0.21
129 0.19
130 0.15
131 0.12
132 0.1
133 0.09
134 0.08
135 0.07
136 0.06
137 0.05
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.05
144 0.06
145 0.09
146 0.09
147 0.1
148 0.12
149 0.14
150 0.14
151 0.13
152 0.13
153 0.11
154 0.1
155 0.09
156 0.08
157 0.08
158 0.09
159 0.08
160 0.08
161 0.08
162 0.09
163 0.1
164 0.09
165 0.12
166 0.12
167 0.12
168 0.19
169 0.19
170 0.2
171 0.23
172 0.23
173 0.19
174 0.18
175 0.18
176 0.11
177 0.11
178 0.12
179 0.08
180 0.09
181 0.09
182 0.1
183 0.1
184 0.11
185 0.11
186 0.09
187 0.1
188 0.09
189 0.08
190 0.08
191 0.08
192 0.07
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.08
212 0.08
213 0.1
214 0.11
215 0.12
216 0.1
217 0.11
218 0.12
219 0.2
220 0.26
221 0.3
222 0.31
223 0.33
224 0.37
225 0.4
226 0.39
227 0.3
228 0.26
229 0.25
230 0.3
231 0.29
232 0.27
233 0.24
234 0.25
235 0.28
236 0.28
237 0.32
238 0.28
239 0.27
240 0.27
241 0.35
242 0.38
243 0.36
244 0.33
245 0.27
246 0.27
247 0.25
248 0.26
249 0.19
250 0.17
251 0.15
252 0.15
253 0.14
254 0.13
255 0.13
256 0.11
257 0.12
258 0.16
259 0.16
260 0.18
261 0.21
262 0.25
263 0.33
264 0.39
265 0.42
266 0.41
267 0.49
268 0.5
269 0.53
270 0.55
271 0.57
272 0.61
273 0.64
274 0.71
275 0.72
276 0.77
277 0.79
278 0.78
279 0.73
280 0.74
281 0.71
282 0.69
283 0.66
284 0.63
285 0.58
286 0.53
287 0.48
288 0.42
289 0.4
290 0.33
291 0.28
292 0.24
293 0.2
294 0.19
295 0.19
296 0.18
297 0.16
298 0.18
299 0.18
300 0.19
301 0.18
302 0.24