Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317UQ06

Protein Details
Accession A0A317UQ06    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
306-327EEYKEERRLAKEQRKKERGEGABasic
NLS Segment(s)
PositionSequence
313-324RLAKEQRKKERG
339-340KK
Subcellular Location(s) cyto 13.5, cyto_nucl 10.5, nucl 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019560  Mitochondrial_18_kDa_protein  
Pfam View protein in Pfam  
PF10558  MTP18  
Amino Acid Sequences MFWGKQHKEDKATPEADEQPIPRSKLPAALQTLADRDDDFYDDIYSPYSVDSTETPYRYAGYANRLRTILLSAHRYVAYTSDIGESFRPVAHPWLVRSAYGISWTYLIGDVAHEGYKAYLRNRLVLAPPCEAYKDASANPNHQRTEPAKLTPTTTNTSATTATGPDTLTPWPTTHVPLVEDYRMVMAKRAVFQSIASMGLPALTIHSVVKYSGRALKGRKSVFLRTWVPIGLGLSVVPFLPYLFDYPVEEAVEWSFRTGLRAYAGEDAVRPLPRVSHATSSGHSASVHAETGSADVDANAETPSWEEYKEERRLAKEQRKKERGEGAGVLGMLGWGDKKKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.46
4 0.44
5 0.39
6 0.37
7 0.4
8 0.41
9 0.37
10 0.36
11 0.34
12 0.38
13 0.4
14 0.4
15 0.4
16 0.39
17 0.39
18 0.38
19 0.39
20 0.32
21 0.29
22 0.22
23 0.18
24 0.17
25 0.17
26 0.15
27 0.14
28 0.15
29 0.14
30 0.14
31 0.14
32 0.13
33 0.11
34 0.1
35 0.1
36 0.08
37 0.09
38 0.1
39 0.16
40 0.22
41 0.22
42 0.23
43 0.23
44 0.24
45 0.23
46 0.25
47 0.21
48 0.25
49 0.31
50 0.33
51 0.35
52 0.34
53 0.34
54 0.32
55 0.31
56 0.26
57 0.24
58 0.26
59 0.24
60 0.26
61 0.26
62 0.26
63 0.23
64 0.2
65 0.18
66 0.13
67 0.13
68 0.12
69 0.13
70 0.13
71 0.13
72 0.13
73 0.12
74 0.12
75 0.12
76 0.11
77 0.14
78 0.18
79 0.19
80 0.19
81 0.26
82 0.26
83 0.25
84 0.26
85 0.23
86 0.19
87 0.2
88 0.19
89 0.12
90 0.12
91 0.12
92 0.11
93 0.09
94 0.09
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.06
101 0.06
102 0.06
103 0.09
104 0.11
105 0.12
106 0.17
107 0.18
108 0.2
109 0.21
110 0.23
111 0.26
112 0.29
113 0.31
114 0.27
115 0.27
116 0.24
117 0.24
118 0.22
119 0.19
120 0.16
121 0.15
122 0.15
123 0.2
124 0.21
125 0.27
126 0.33
127 0.37
128 0.35
129 0.33
130 0.37
131 0.33
132 0.39
133 0.35
134 0.31
135 0.29
136 0.29
137 0.32
138 0.29
139 0.31
140 0.26
141 0.24
142 0.24
143 0.21
144 0.22
145 0.19
146 0.17
147 0.14
148 0.11
149 0.1
150 0.09
151 0.08
152 0.07
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.1
159 0.11
160 0.12
161 0.12
162 0.12
163 0.12
164 0.13
165 0.15
166 0.13
167 0.12
168 0.1
169 0.1
170 0.11
171 0.1
172 0.09
173 0.09
174 0.1
175 0.13
176 0.13
177 0.13
178 0.12
179 0.12
180 0.12
181 0.11
182 0.1
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.06
196 0.07
197 0.07
198 0.09
199 0.14
200 0.16
201 0.2
202 0.23
203 0.3
204 0.37
205 0.38
206 0.41
207 0.41
208 0.45
209 0.43
210 0.47
211 0.43
212 0.37
213 0.37
214 0.31
215 0.27
216 0.22
217 0.2
218 0.12
219 0.09
220 0.07
221 0.06
222 0.06
223 0.05
224 0.05
225 0.04
226 0.04
227 0.05
228 0.05
229 0.07
230 0.08
231 0.09
232 0.1
233 0.11
234 0.13
235 0.12
236 0.12
237 0.11
238 0.11
239 0.12
240 0.11
241 0.1
242 0.09
243 0.09
244 0.11
245 0.11
246 0.12
247 0.12
248 0.13
249 0.14
250 0.17
251 0.17
252 0.15
253 0.15
254 0.16
255 0.17
256 0.17
257 0.17
258 0.14
259 0.15
260 0.17
261 0.22
262 0.23
263 0.25
264 0.27
265 0.29
266 0.3
267 0.34
268 0.31
269 0.28
270 0.24
271 0.2
272 0.18
273 0.17
274 0.17
275 0.12
276 0.11
277 0.1
278 0.11
279 0.11
280 0.08
281 0.07
282 0.06
283 0.07
284 0.07
285 0.07
286 0.06
287 0.06
288 0.06
289 0.07
290 0.1
291 0.1
292 0.1
293 0.13
294 0.18
295 0.27
296 0.34
297 0.39
298 0.41
299 0.45
300 0.53
301 0.62
302 0.67
303 0.68
304 0.71
305 0.77
306 0.81
307 0.81
308 0.81
309 0.8
310 0.73
311 0.7
312 0.62
313 0.53
314 0.47
315 0.41
316 0.33
317 0.23
318 0.18
319 0.11
320 0.09
321 0.08
322 0.11