Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317VN92

Protein Details
Accession A0A317VN92    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-71VTERAPRRSRRSKIKGADLSSHydrophilic
NLS Segment(s)
PositionSequence
57-63RRSRRSK
Subcellular Location(s) mito 14, cyto 5, nucl 4, pero 2
Family & Domain DBs
Amino Acid Sequences MTLPPRYYVPFLHLQLAAAASEVGPIDQAMSILKIPSYQGRVACLCVCRLVTERAPRRSRRSKIKGADLSSFLVFFFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.19
5 0.11
6 0.09
7 0.06
8 0.06
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.08
24 0.11
25 0.12
26 0.12
27 0.15
28 0.15
29 0.17
30 0.18
31 0.16
32 0.14
33 0.13
34 0.13
35 0.12
36 0.14
37 0.17
38 0.21
39 0.3
40 0.38
41 0.46
42 0.54
43 0.59
44 0.66
45 0.72
46 0.76
47 0.77
48 0.78
49 0.79
50 0.79
51 0.84
52 0.82
53 0.76
54 0.72
55 0.63
56 0.57
57 0.47
58 0.39