Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WRI4

Protein Details
Accession A0A317WRI4   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-81GDSNSHHSSKKKKKNKRKNKRKNRRKNKRSTLPHQRTDPBasic
NLS Segment(s)
PositionSequence
51-72SKKKKKNKRKNKRKNRRKNKRS
Subcellular Location(s) nucl 19, mito 3, cyto 2, plas 1, extr 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MSSFVNTSLLSSPLNQAPGAAAATAVSGGITININPNSNRNGGDSNSHHSSKKKKKNKRKNKRKNRRKNKRSTLPHQRTDPLPRPPSFLPSRPPLPSQGPRGFGSGFGFGSGFGSVFGQQRPAHLPFRPGWLSRRDRWVDARVGHRVEREEGQGQGREVVGWEVDRQEAWRCQGETQTQTQTQTQTQTWVVARQKEEAEEENPRMIKIEDEDEDGNENKNMNTSECKNETVEDEEFEEEYEEDDRWYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.16
5 0.17
6 0.16
7 0.12
8 0.08
9 0.07
10 0.07
11 0.07
12 0.06
13 0.04
14 0.03
15 0.03
16 0.04
17 0.05
18 0.05
19 0.11
20 0.13
21 0.16
22 0.17
23 0.2
24 0.23
25 0.24
26 0.25
27 0.22
28 0.24
29 0.23
30 0.29
31 0.29
32 0.33
33 0.36
34 0.37
35 0.37
36 0.4
37 0.49
38 0.53
39 0.61
40 0.65
41 0.71
42 0.8
43 0.89
44 0.95
45 0.95
46 0.96
47 0.96
48 0.97
49 0.98
50 0.98
51 0.98
52 0.98
53 0.98
54 0.97
55 0.97
56 0.97
57 0.96
58 0.94
59 0.93
60 0.93
61 0.91
62 0.87
63 0.8
64 0.72
65 0.65
66 0.65
67 0.61
68 0.59
69 0.56
70 0.5
71 0.51
72 0.48
73 0.51
74 0.46
75 0.42
76 0.38
77 0.37
78 0.41
79 0.38
80 0.39
81 0.36
82 0.38
83 0.4
84 0.43
85 0.42
86 0.41
87 0.39
88 0.4
89 0.35
90 0.29
91 0.26
92 0.19
93 0.14
94 0.11
95 0.1
96 0.08
97 0.08
98 0.07
99 0.05
100 0.04
101 0.05
102 0.06
103 0.07
104 0.07
105 0.11
106 0.11
107 0.12
108 0.16
109 0.19
110 0.2
111 0.19
112 0.23
113 0.2
114 0.25
115 0.26
116 0.24
117 0.24
118 0.3
119 0.35
120 0.35
121 0.42
122 0.39
123 0.39
124 0.42
125 0.43
126 0.39
127 0.38
128 0.39
129 0.35
130 0.35
131 0.33
132 0.31
133 0.28
134 0.25
135 0.23
136 0.22
137 0.19
138 0.19
139 0.2
140 0.19
141 0.18
142 0.17
143 0.15
144 0.12
145 0.11
146 0.09
147 0.07
148 0.06
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.12
155 0.14
156 0.16
157 0.2
158 0.2
159 0.21
160 0.25
161 0.29
162 0.28
163 0.31
164 0.33
165 0.31
166 0.32
167 0.33
168 0.32
169 0.29
170 0.3
171 0.26
172 0.24
173 0.23
174 0.24
175 0.23
176 0.28
177 0.3
178 0.31
179 0.32
180 0.32
181 0.33
182 0.3
183 0.33
184 0.29
185 0.28
186 0.28
187 0.29
188 0.3
189 0.29
190 0.27
191 0.26
192 0.23
193 0.21
194 0.18
195 0.2
196 0.17
197 0.21
198 0.21
199 0.21
200 0.23
201 0.23
202 0.22
203 0.18
204 0.18
205 0.14
206 0.17
207 0.17
208 0.17
209 0.23
210 0.25
211 0.32
212 0.34
213 0.37
214 0.34
215 0.35
216 0.35
217 0.33
218 0.31
219 0.24
220 0.24
221 0.23
222 0.22
223 0.2
224 0.19
225 0.13
226 0.13
227 0.13
228 0.11