Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VQB8

Protein Details
Accession A0A317VQB8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
31-56DQQSAQHDRRRNRTHKREKNALPQAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MDGERGRSQRSDEVVVVVFQREGRRGNSGGDQQSAQHDRRRNRTHKREKNALPQAHSNEGSGRGGID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.18
5 0.15
6 0.13
7 0.14
8 0.14
9 0.15
10 0.16
11 0.2
12 0.2
13 0.22
14 0.23
15 0.27
16 0.26
17 0.25
18 0.23
19 0.2
20 0.23
21 0.25
22 0.23
23 0.23
24 0.28
25 0.33
26 0.43
27 0.52
28 0.57
29 0.65
30 0.74
31 0.8
32 0.84
33 0.88
34 0.88
35 0.86
36 0.87
37 0.86
38 0.8
39 0.73
40 0.7
41 0.66
42 0.62
43 0.55
44 0.45
45 0.37
46 0.35
47 0.31