Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N3X7

Protein Details
Accession A8N3X7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
89-113LKSSMSTLRKRDKKREKVRAEQAALHydrophilic
122-149VVLSGPKRGNGRRKRQRQLKALAKQEVSHydrophilic
NLS Segment(s)
PositionSequence
97-167RKRDKKREKVRAEQAALRKKKMTEPVVLSGPKRGNGRRKRQRQLKALAKQEVSQQKFKEREEARRKAEQAR
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG cci:CC1G_10102  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MQLVDHDTFLRQLAALFESSKEKGSIWITHKRLTHDGEDAAMKHEDEGAEDTREYPCLLRVTNGKDTKFSTKVDASQLPKFYSAYGSLLKSSMSTLRKRDKKREKVRAEQAALRKKKMTEPVVLSGPKRGNGRRKRQRQLKALAKQEVSQQKFKEREEARRKAEQARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.17
6 0.18
7 0.19
8 0.17
9 0.16
10 0.2
11 0.23
12 0.29
13 0.3
14 0.39
15 0.41
16 0.45
17 0.48
18 0.48
19 0.5
20 0.46
21 0.44
22 0.37
23 0.34
24 0.31
25 0.29
26 0.25
27 0.22
28 0.19
29 0.16
30 0.12
31 0.13
32 0.11
33 0.1
34 0.13
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.14
41 0.13
42 0.1
43 0.11
44 0.12
45 0.12
46 0.14
47 0.18
48 0.23
49 0.31
50 0.35
51 0.33
52 0.33
53 0.36
54 0.39
55 0.37
56 0.33
57 0.28
58 0.25
59 0.27
60 0.29
61 0.32
62 0.29
63 0.3
64 0.31
65 0.28
66 0.27
67 0.25
68 0.21
69 0.17
70 0.14
71 0.12
72 0.12
73 0.12
74 0.11
75 0.11
76 0.11
77 0.1
78 0.1
79 0.13
80 0.15
81 0.19
82 0.25
83 0.35
84 0.44
85 0.5
86 0.6
87 0.66
88 0.73
89 0.81
90 0.85
91 0.84
92 0.85
93 0.88
94 0.85
95 0.78
96 0.73
97 0.7
98 0.69
99 0.64
100 0.56
101 0.5
102 0.42
103 0.45
104 0.47
105 0.43
106 0.4
107 0.41
108 0.43
109 0.46
110 0.47
111 0.41
112 0.39
113 0.37
114 0.34
115 0.35
116 0.38
117 0.43
118 0.51
119 0.62
120 0.67
121 0.76
122 0.83
123 0.87
124 0.9
125 0.89
126 0.89
127 0.89
128 0.86
129 0.84
130 0.8
131 0.72
132 0.63
133 0.63
134 0.62
135 0.57
136 0.55
137 0.49
138 0.51
139 0.56
140 0.56
141 0.57
142 0.54
143 0.6
144 0.64
145 0.7
146 0.67
147 0.71
148 0.73