Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PAU4

Protein Details
Accession A8PAU4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRSKHRNQKSTNNETKPSHydrophilic
50-70PPKPSLARTRIRKNRRPSLDKBasic
NLS Segment(s)
PositionSequence
57-64RTRIRKNR
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
KEGG cci:CC1G_13112  -  
Amino Acid Sequences MSSKRSKHRNQKSTNNETKPSPLTAVPPSKTPSSNPPSRWRYVELPETPPPKPSLARTRIRKNRRPSLDKVDDPDTDSSTEYLPFPKRRKGTPVTDDGLSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.86
3 0.78
4 0.7
5 0.66
6 0.58
7 0.49
8 0.41
9 0.31
10 0.29
11 0.33
12 0.37
13 0.33
14 0.33
15 0.34
16 0.34
17 0.35
18 0.33
19 0.35
20 0.35
21 0.41
22 0.43
23 0.49
24 0.52
25 0.54
26 0.55
27 0.5
28 0.46
29 0.44
30 0.47
31 0.4
32 0.39
33 0.42
34 0.43
35 0.38
36 0.36
37 0.32
38 0.27
39 0.25
40 0.25
41 0.29
42 0.34
43 0.42
44 0.49
45 0.59
46 0.67
47 0.75
48 0.78
49 0.78
50 0.8
51 0.81
52 0.8
53 0.76
54 0.77
55 0.75
56 0.7
57 0.65
58 0.59
59 0.5
60 0.46
61 0.41
62 0.32
63 0.24
64 0.22
65 0.18
66 0.14
67 0.15
68 0.13
69 0.17
70 0.22
71 0.3
72 0.35
73 0.43
74 0.47
75 0.52
76 0.6
77 0.62
78 0.65
79 0.65
80 0.67
81 0.62