Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WIN7

Protein Details
Accession A0A317WIN7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
148-175VLTGHDTPSEKPKRRKPWEKEKGIEDQDBasic
NLS Segment(s)
PositionSequence
158-167KPKRRKPWEK
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MAELRPLEVEQFERLSSYPFSADREFAVGLSIILGHPELPASEAEINRSDDLTLQAKCFYFSRKEKLTPPLNFSDYKTWLGSAPAGAASLIKTAMQQSNPAGFSSTNHTGDIPKSSEEPAYPSSFAHIVELITTGQPIPGIQQIPDTVLTGHDTPSEKPKRRKPWEKEKGIEDQDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.17
5 0.17
6 0.17
7 0.21
8 0.22
9 0.22
10 0.2
11 0.21
12 0.2
13 0.17
14 0.17
15 0.12
16 0.1
17 0.09
18 0.08
19 0.05
20 0.05
21 0.06
22 0.05
23 0.04
24 0.05
25 0.05
26 0.05
27 0.06
28 0.08
29 0.12
30 0.12
31 0.14
32 0.17
33 0.19
34 0.18
35 0.18
36 0.15
37 0.13
38 0.16
39 0.17
40 0.16
41 0.14
42 0.16
43 0.16
44 0.17
45 0.18
46 0.18
47 0.22
48 0.27
49 0.33
50 0.36
51 0.4
52 0.43
53 0.51
54 0.57
55 0.51
56 0.51
57 0.48
58 0.46
59 0.43
60 0.41
61 0.37
62 0.31
63 0.29
64 0.25
65 0.21
66 0.18
67 0.18
68 0.15
69 0.1
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.08
82 0.08
83 0.1
84 0.11
85 0.13
86 0.14
87 0.14
88 0.13
89 0.11
90 0.12
91 0.17
92 0.2
93 0.18
94 0.18
95 0.19
96 0.19
97 0.2
98 0.22
99 0.17
100 0.14
101 0.14
102 0.15
103 0.15
104 0.14
105 0.17
106 0.17
107 0.18
108 0.17
109 0.16
110 0.17
111 0.17
112 0.17
113 0.14
114 0.11
115 0.09
116 0.09
117 0.1
118 0.08
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.1
127 0.11
128 0.11
129 0.13
130 0.13
131 0.15
132 0.16
133 0.15
134 0.11
135 0.11
136 0.14
137 0.13
138 0.13
139 0.15
140 0.16
141 0.18
142 0.28
143 0.38
144 0.44
145 0.53
146 0.63
147 0.71
148 0.8
149 0.89
150 0.89
151 0.9
152 0.92
153 0.92
154 0.89
155 0.84
156 0.82