Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317UZ14

Protein Details
Accession A0A317UZ14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-91LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
73-90PKKKTSHMKKRHRQMAGK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALRLLPSSLSSQMLPRSRLLTEFLSAAAVGRWSGFALNASAWSHNLLGPPAISLNIPGITAGLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKGLSTCSGCGQVKRSHVLCPNCVESVKKQWKHTQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.29
4 0.3
5 0.29
6 0.3
7 0.3
8 0.25
9 0.21
10 0.19
11 0.17
12 0.15
13 0.14
14 0.13
15 0.09
16 0.07
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.08
27 0.09
28 0.09
29 0.09
30 0.1
31 0.1
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.05
57 0.09
58 0.12
59 0.17
60 0.23
61 0.25
62 0.31
63 0.41
64 0.51
65 0.59
66 0.67
67 0.73
68 0.78
69 0.85
70 0.88
71 0.85
72 0.81
73 0.78
74 0.78
75 0.75
76 0.68
77 0.62
78 0.56
79 0.49
80 0.44
81 0.36
82 0.29
83 0.23
84 0.22
85 0.2
86 0.18
87 0.17
88 0.18
89 0.23
90 0.21
91 0.21
92 0.25
93 0.28
94 0.31
95 0.37
96 0.37
97 0.38
98 0.45
99 0.47
100 0.46
101 0.46
102 0.46
103 0.41
104 0.42
105 0.38
106 0.36
107 0.42
108 0.49
109 0.49
110 0.53
111 0.61