Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1DVK2

Protein Details
Accession A0A0D1DVK2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
159-193LRLQQRYEKPNEERRRKKSERHRRRFADMVRRKVQBasic
NLS Segment(s)
PositionSequence
169-190NEERRRKKSERHRRRFADMVRR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG uma:UMAG_04244  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSLLRDSVVRSLRRAVSSTLPARSALSGSSSSVSCTDVNMLCRSFASTSLRADANKYSPLKPATSAASTYTAILDSLQDSYEKSTRGSGSRFSRPSDGRRGYVEDLESDWSERAVYGEPSWPATPFSGRSIRVTPQADPARAYAQLSVLLRRNNVRQELRLQQRYEKPNEERRRKKSERHRRRFADMVRRKVQLVMAIKARGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.36
4 0.42
5 0.45
6 0.41
7 0.37
8 0.35
9 0.34
10 0.31
11 0.26
12 0.18
13 0.16
14 0.14
15 0.14
16 0.15
17 0.14
18 0.14
19 0.14
20 0.16
21 0.13
22 0.12
23 0.15
24 0.15
25 0.18
26 0.2
27 0.2
28 0.18
29 0.18
30 0.2
31 0.17
32 0.18
33 0.21
34 0.21
35 0.22
36 0.24
37 0.26
38 0.24
39 0.25
40 0.25
41 0.22
42 0.26
43 0.27
44 0.26
45 0.3
46 0.31
47 0.3
48 0.28
49 0.28
50 0.24
51 0.23
52 0.23
53 0.19
54 0.2
55 0.19
56 0.18
57 0.15
58 0.12
59 0.1
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.09
68 0.11
69 0.11
70 0.11
71 0.13
72 0.15
73 0.17
74 0.18
75 0.22
76 0.25
77 0.33
78 0.34
79 0.33
80 0.37
81 0.38
82 0.41
83 0.44
84 0.42
85 0.36
86 0.35
87 0.37
88 0.33
89 0.31
90 0.27
91 0.17
92 0.15
93 0.15
94 0.14
95 0.1
96 0.09
97 0.08
98 0.07
99 0.06
100 0.07
101 0.06
102 0.07
103 0.07
104 0.1
105 0.1
106 0.12
107 0.13
108 0.12
109 0.12
110 0.12
111 0.13
112 0.12
113 0.17
114 0.19
115 0.2
116 0.23
117 0.24
118 0.26
119 0.31
120 0.31
121 0.28
122 0.32
123 0.36
124 0.34
125 0.32
126 0.31
127 0.27
128 0.25
129 0.25
130 0.16
131 0.12
132 0.15
133 0.15
134 0.17
135 0.19
136 0.2
137 0.22
138 0.25
139 0.29
140 0.31
141 0.38
142 0.38
143 0.37
144 0.42
145 0.5
146 0.56
147 0.58
148 0.55
149 0.55
150 0.6
151 0.65
152 0.65
153 0.64
154 0.62
155 0.66
156 0.75
157 0.78
158 0.79
159 0.8
160 0.84
161 0.83
162 0.85
163 0.86
164 0.87
165 0.87
166 0.87
167 0.9
168 0.86
169 0.87
170 0.86
171 0.84
172 0.84
173 0.82
174 0.81
175 0.76
176 0.72
177 0.64
178 0.57
179 0.5
180 0.47
181 0.42
182 0.38
183 0.38