Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N5P3

Protein Details
Accession A8N5P3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-32RLYSKGRVLGHKRGKRNTRPNTSLIHydrophilic
NLS Segment(s)
PositionSequence
20-21RG
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_09348  -  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MLKTFSNRLYSKGRVLGHKRGKRNTRPNTSLIQIEGVASKEDAQFYLGKRVAYVYKAKREIQGSKIRVIWGRVTRPHGSSGVVKSKFRSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.6
4 0.63
5 0.67
6 0.71
7 0.74
8 0.8
9 0.81
10 0.85
11 0.85
12 0.84
13 0.81
14 0.76
15 0.7
16 0.62
17 0.53
18 0.43
19 0.34
20 0.23
21 0.19
22 0.16
23 0.12
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.09
31 0.1
32 0.1
33 0.18
34 0.18
35 0.17
36 0.17
37 0.18
38 0.18
39 0.19
40 0.25
41 0.23
42 0.28
43 0.32
44 0.33
45 0.35
46 0.39
47 0.4
48 0.4
49 0.44
50 0.4
51 0.39
52 0.39
53 0.37
54 0.35
55 0.33
56 0.32
57 0.28
58 0.32
59 0.33
60 0.38
61 0.38
62 0.38
63 0.39
64 0.33
65 0.3
66 0.29
67 0.31
68 0.34
69 0.35
70 0.35
71 0.34
72 0.41
73 0.43
74 0.41
75 0.46
76 0.43
77 0.51
78 0.56
79 0.58
80 0.52
81 0.49
82 0.47
83 0.37
84 0.35
85 0.25
86 0.2
87 0.16
88 0.15
89 0.13