Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NHM6

Protein Details
Accession A8NHM6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-23ASNTRGKKAAHRPNRNASSMHydrophilic
93-119HNANKHLKTKRHQRKMEVWKAKKRSELBasic
NLS Segment(s)
PositionSequence
99-116LKTKRHQRKMEVWKAKKR
Subcellular Location(s) nucl 14, mito_nucl 12, mito 8, cyto 5
Family & Domain DBs
KEGG cci:CC1G_12176  -  
Amino Acid Sequences MAVASNTRGKKAAHRPNRNASSMIKGTPRTAPRPCATVYRGMAERIHWFTARSEIFGILTPTKVRCKMCNRNLKLECPKKTVQENTKGGYYHHNANKHLKTKRHQRKMEVWKAKKRSELAVLRLRVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.79
4 0.84
5 0.77
6 0.7
7 0.61
8 0.58
9 0.5
10 0.44
11 0.38
12 0.33
13 0.33
14 0.37
15 0.4
16 0.39
17 0.41
18 0.44
19 0.41
20 0.43
21 0.42
22 0.41
23 0.37
24 0.38
25 0.35
26 0.32
27 0.32
28 0.3
29 0.29
30 0.24
31 0.27
32 0.22
33 0.23
34 0.19
35 0.18
36 0.17
37 0.23
38 0.22
39 0.18
40 0.16
41 0.14
42 0.14
43 0.14
44 0.15
45 0.09
46 0.1
47 0.1
48 0.11
49 0.14
50 0.17
51 0.18
52 0.23
53 0.32
54 0.42
55 0.5
56 0.59
57 0.6
58 0.66
59 0.68
60 0.69
61 0.7
62 0.68
63 0.63
64 0.59
65 0.58
66 0.52
67 0.56
68 0.57
69 0.54
70 0.55
71 0.54
72 0.51
73 0.51
74 0.47
75 0.41
76 0.39
77 0.35
78 0.34
79 0.35
80 0.38
81 0.39
82 0.48
83 0.54
84 0.56
85 0.6
86 0.59
87 0.63
88 0.7
89 0.77
90 0.79
91 0.79
92 0.78
93 0.82
94 0.85
95 0.87
96 0.87
97 0.85
98 0.85
99 0.86
100 0.83
101 0.8
102 0.72
103 0.67
104 0.66
105 0.64
106 0.62
107 0.63