Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VHP1

Protein Details
Accession A0A317VHP1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27HPDAAVAKPRPKRRPRICRACDACYKHydrophilic
NLS Segment(s)
PositionSequence
9-16KPRPKRRP
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MHPDAAVAKPRPKRRPRICRACDACYKRKIQCDAATPRCNWCHHHDLPCTFKRNQERNQARSKAHQHHPSEYGLVMRQRKFAKTCFQHPTVQFQRNTRPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.89
4 0.92
5 0.88
6 0.88
7 0.85
8 0.8
9 0.79
10 0.76
11 0.73
12 0.68
13 0.68
14 0.62
15 0.63
16 0.62
17 0.58
18 0.55
19 0.56
20 0.59
21 0.62
22 0.61
23 0.55
24 0.55
25 0.52
26 0.48
27 0.43
28 0.4
29 0.39
30 0.39
31 0.45
32 0.44
33 0.44
34 0.49
35 0.5
36 0.49
37 0.41
38 0.43
39 0.46
40 0.49
41 0.52
42 0.56
43 0.6
44 0.61
45 0.7
46 0.7
47 0.62
48 0.62
49 0.64
50 0.61
51 0.61
52 0.64
53 0.59
54 0.57
55 0.58
56 0.51
57 0.44
58 0.36
59 0.29
60 0.23
61 0.26
62 0.28
63 0.26
64 0.31
65 0.33
66 0.38
67 0.4
68 0.41
69 0.46
70 0.47
71 0.54
72 0.56
73 0.57
74 0.59
75 0.58
76 0.63
77 0.62
78 0.63
79 0.59
80 0.57
81 0.64