Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317VF60

Protein Details
Accession A0A317VF60    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-72TDPYVCFRRREVRQTRKTRGRDAQSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024943  Enhancer_polycomb  
Gene Ontology GO:0032777  C:Piccolo NuA4 histone acetyltransferase complex  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MDPAVEESVKRFAKDIYEYWKSRRTSGGSDPLLPTPKIEAGRDTDDTDPYVCFRRREVRQTRKTRGRDAQSADKLRRLRKELEDARQMVALVRQRELARKEMLAIERQVFMQRSEVKEMKRKLNIKDDDEDLINQKPKKKPAEAPAVQRPAAPQLRMPPKAGTQAAEDLQLLEDVQAEKENEILRDIKQNITKHIKWNEGYVDFTRAPLSPSPDRMFDSAFRPAITTQLPTPPSSDSSENLLESALDTTSAIALRDKLAPHAMELSEDTSQMPSFRRRIGRGGRLWIDRRKLASRCRVEMDPWKADRFKYDQEDSDDDLDFDRDQYDIQIMQHRAIMAAKARDQQAAAAAQAHAQAQAAQAQAQARRLQAEQTSATNPPSGGQTMGSNPGPGAIASTSET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.37
4 0.44
5 0.47
6 0.52
7 0.58
8 0.53
9 0.51
10 0.53
11 0.5
12 0.47
13 0.53
14 0.57
15 0.53
16 0.55
17 0.54
18 0.52
19 0.51
20 0.44
21 0.36
22 0.3
23 0.32
24 0.3
25 0.29
26 0.27
27 0.28
28 0.34
29 0.35
30 0.35
31 0.31
32 0.3
33 0.3
34 0.27
35 0.22
36 0.19
37 0.25
38 0.26
39 0.25
40 0.3
41 0.38
42 0.45
43 0.55
44 0.64
45 0.67
46 0.74
47 0.83
48 0.88
49 0.89
50 0.87
51 0.86
52 0.85
53 0.82
54 0.79
55 0.76
56 0.75
57 0.75
58 0.76
59 0.69
60 0.66
61 0.65
62 0.63
63 0.64
64 0.59
65 0.57
66 0.55
67 0.63
68 0.65
69 0.67
70 0.69
71 0.62
72 0.58
73 0.52
74 0.45
75 0.35
76 0.31
77 0.28
78 0.21
79 0.2
80 0.23
81 0.23
82 0.3
83 0.32
84 0.32
85 0.29
86 0.28
87 0.29
88 0.3
89 0.31
90 0.28
91 0.28
92 0.25
93 0.23
94 0.23
95 0.25
96 0.21
97 0.19
98 0.22
99 0.24
100 0.25
101 0.32
102 0.35
103 0.36
104 0.44
105 0.49
106 0.5
107 0.54
108 0.57
109 0.56
110 0.62
111 0.64
112 0.6
113 0.57
114 0.52
115 0.45
116 0.4
117 0.35
118 0.27
119 0.26
120 0.26
121 0.25
122 0.3
123 0.33
124 0.4
125 0.46
126 0.5
127 0.53
128 0.56
129 0.65
130 0.63
131 0.65
132 0.67
133 0.64
134 0.58
135 0.51
136 0.43
137 0.4
138 0.38
139 0.3
140 0.23
141 0.27
142 0.35
143 0.37
144 0.38
145 0.32
146 0.31
147 0.36
148 0.35
149 0.28
150 0.21
151 0.22
152 0.2
153 0.19
154 0.17
155 0.12
156 0.11
157 0.1
158 0.08
159 0.05
160 0.06
161 0.05
162 0.05
163 0.07
164 0.07
165 0.07
166 0.09
167 0.1
168 0.09
169 0.1
170 0.11
171 0.11
172 0.17
173 0.18
174 0.2
175 0.24
176 0.25
177 0.31
178 0.37
179 0.38
180 0.39
181 0.43
182 0.44
183 0.39
184 0.4
185 0.37
186 0.3
187 0.31
188 0.24
189 0.24
190 0.19
191 0.19
192 0.17
193 0.14
194 0.15
195 0.14
196 0.19
197 0.16
198 0.21
199 0.22
200 0.23
201 0.24
202 0.23
203 0.23
204 0.2
205 0.21
206 0.2
207 0.19
208 0.18
209 0.17
210 0.16
211 0.17
212 0.16
213 0.14
214 0.11
215 0.16
216 0.17
217 0.17
218 0.18
219 0.17
220 0.19
221 0.2
222 0.21
223 0.16
224 0.19
225 0.2
226 0.18
227 0.17
228 0.15
229 0.11
230 0.1
231 0.1
232 0.05
233 0.04
234 0.04
235 0.04
236 0.05
237 0.06
238 0.06
239 0.05
240 0.06
241 0.08
242 0.1
243 0.11
244 0.12
245 0.14
246 0.14
247 0.14
248 0.16
249 0.14
250 0.13
251 0.13
252 0.14
253 0.11
254 0.11
255 0.11
256 0.09
257 0.1
258 0.1
259 0.13
260 0.16
261 0.19
262 0.25
263 0.3
264 0.32
265 0.41
266 0.49
267 0.55
268 0.54
269 0.58
270 0.58
271 0.59
272 0.62
273 0.6
274 0.56
275 0.51
276 0.51
277 0.51
278 0.51
279 0.53
280 0.57
281 0.57
282 0.56
283 0.57
284 0.55
285 0.52
286 0.55
287 0.54
288 0.51
289 0.48
290 0.49
291 0.46
292 0.45
293 0.45
294 0.41
295 0.41
296 0.41
297 0.42
298 0.41
299 0.45
300 0.48
301 0.46
302 0.42
303 0.35
304 0.28
305 0.25
306 0.22
307 0.16
308 0.13
309 0.1
310 0.08
311 0.08
312 0.08
313 0.1
314 0.1
315 0.12
316 0.19
317 0.2
318 0.21
319 0.22
320 0.21
321 0.2
322 0.2
323 0.2
324 0.18
325 0.21
326 0.24
327 0.27
328 0.29
329 0.29
330 0.29
331 0.27
332 0.25
333 0.22
334 0.19
335 0.16
336 0.15
337 0.14
338 0.16
339 0.15
340 0.11
341 0.1
342 0.1
343 0.09
344 0.13
345 0.12
346 0.11
347 0.13
348 0.17
349 0.19
350 0.23
351 0.25
352 0.23
353 0.26
354 0.26
355 0.29
356 0.28
357 0.3
358 0.28
359 0.29
360 0.31
361 0.31
362 0.31
363 0.28
364 0.26
365 0.21
366 0.22
367 0.2
368 0.17
369 0.16
370 0.18
371 0.19
372 0.25
373 0.24
374 0.21
375 0.2
376 0.2
377 0.19
378 0.16
379 0.16
380 0.1