Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NC35

Protein Details
Accession A8NC35    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-61ASGADGDKKKRKKVRKETYSSYIYHydrophilic
NLS Segment(s)
PositionSequence
18-53SKAPAKPAEGAKAAKKTSKPASGADGDKKKRKKVRK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG cci:CC1G_07639  -  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKPASTAGKAPVSTASKAPAKPAEGAKAAKKTSKPASGADGDKKKRKKVRKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTAVRLILPGELAKHAISEGTKSVTKFSSAGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.31
5 0.31
6 0.32
7 0.36
8 0.33
9 0.31
10 0.34
11 0.36
12 0.35
13 0.34
14 0.37
15 0.38
16 0.4
17 0.4
18 0.41
19 0.39
20 0.42
21 0.44
22 0.48
23 0.44
24 0.4
25 0.43
26 0.42
27 0.45
28 0.46
29 0.48
30 0.48
31 0.54
32 0.58
33 0.61
34 0.66
35 0.71
36 0.74
37 0.76
38 0.81
39 0.83
40 0.86
41 0.84
42 0.82
43 0.78
44 0.68
45 0.59
46 0.55
47 0.45
48 0.38
49 0.36
50 0.33
51 0.29
52 0.32
53 0.32
54 0.29
55 0.29
56 0.28
57 0.25
58 0.23
59 0.22
60 0.17
61 0.15
62 0.11
63 0.11
64 0.11
65 0.1
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09
71 0.07
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.1
87 0.14
88 0.17
89 0.2
90 0.24
91 0.28
92 0.29
93 0.34
94 0.38
95 0.4
96 0.43
97 0.42
98 0.41
99 0.38
100 0.37
101 0.34
102 0.3
103 0.25
104 0.19
105 0.16
106 0.12
107 0.12
108 0.12
109 0.11
110 0.1
111 0.1
112 0.1
113 0.1
114 0.1
115 0.09
116 0.1
117 0.1
118 0.11
119 0.13
120 0.16
121 0.19
122 0.19
123 0.22
124 0.22
125 0.23
126 0.21