Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X8T3

Protein Details
Accession A0A317X8T3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
232-255ISAPKKSNTPTGPPKKPKAPRARLHydrophilic
NLS Segment(s)
PositionSequence
240-255TPTGPPKKPKAPRARL
Subcellular Location(s) cyto 13, cyto_nucl 10, pero 9, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044831  Ccp1-like  
IPR002016  Haem_peroxidase  
IPR010255  Haem_peroxidase_sf  
IPR002207  Peroxidase_I  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0004601  F:peroxidase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00141  peroxidase  
PROSITE View protein in PROSITE  
PS50873  PEROXIDASE_4  
Amino Acid Sequences MRYEAEGGDPSNAGLQYGRAFLEPVKEKHPWITYSDLWTLAGVVAIKELGGPEVDWKPGRTDLVDDSKVPPRGRLPDGAQGADHLRFIFNRMGFNDQEIVALAGGHNLGRCHTDRSGFEGPWVNNPTRFSNQFFKLLLQLKWTPRKLANGMSQFVYEDPDAEEGDELLMMLPTDVALKTDPSFRQWVERYAEDKDLFFDHFAKAFAKLVELGIRRDEKDAILNTDNVKGGYISAPKKSNTPTGPPKKPKAPRARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.14
6 0.11
7 0.12
8 0.13
9 0.21
10 0.27
11 0.28
12 0.32
13 0.33
14 0.35
15 0.4
16 0.44
17 0.37
18 0.34
19 0.38
20 0.35
21 0.38
22 0.38
23 0.32
24 0.27
25 0.25
26 0.22
27 0.15
28 0.14
29 0.09
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.09
40 0.11
41 0.14
42 0.15
43 0.16
44 0.19
45 0.2
46 0.21
47 0.18
48 0.19
49 0.22
50 0.28
51 0.29
52 0.27
53 0.29
54 0.34
55 0.39
56 0.37
57 0.34
58 0.31
59 0.35
60 0.37
61 0.38
62 0.35
63 0.37
64 0.39
65 0.37
66 0.32
67 0.28
68 0.27
69 0.22
70 0.19
71 0.11
72 0.1
73 0.09
74 0.12
75 0.15
76 0.14
77 0.16
78 0.17
79 0.2
80 0.2
81 0.21
82 0.2
83 0.15
84 0.14
85 0.12
86 0.11
87 0.07
88 0.07
89 0.05
90 0.04
91 0.04
92 0.04
93 0.05
94 0.04
95 0.05
96 0.08
97 0.09
98 0.12
99 0.13
100 0.16
101 0.16
102 0.24
103 0.26
104 0.24
105 0.25
106 0.27
107 0.26
108 0.29
109 0.31
110 0.24
111 0.23
112 0.25
113 0.26
114 0.25
115 0.27
116 0.25
117 0.28
118 0.3
119 0.31
120 0.29
121 0.26
122 0.28
123 0.3
124 0.26
125 0.24
126 0.26
127 0.3
128 0.37
129 0.37
130 0.35
131 0.33
132 0.38
133 0.36
134 0.37
135 0.39
136 0.35
137 0.35
138 0.33
139 0.31
140 0.26
141 0.24
142 0.2
143 0.12
144 0.09
145 0.08
146 0.08
147 0.08
148 0.08
149 0.08
150 0.06
151 0.06
152 0.05
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.05
163 0.05
164 0.07
165 0.08
166 0.13
167 0.14
168 0.17
169 0.2
170 0.2
171 0.28
172 0.28
173 0.33
174 0.32
175 0.36
176 0.35
177 0.35
178 0.4
179 0.33
180 0.31
181 0.27
182 0.24
183 0.21
184 0.2
185 0.18
186 0.14
187 0.14
188 0.15
189 0.14
190 0.14
191 0.15
192 0.14
193 0.13
194 0.13
195 0.13
196 0.18
197 0.19
198 0.19
199 0.23
200 0.26
201 0.26
202 0.27
203 0.27
204 0.22
205 0.27
206 0.28
207 0.28
208 0.28
209 0.29
210 0.29
211 0.31
212 0.3
213 0.24
214 0.21
215 0.16
216 0.15
217 0.16
218 0.22
219 0.23
220 0.28
221 0.32
222 0.33
223 0.38
224 0.41
225 0.46
226 0.44
227 0.5
228 0.55
229 0.62
230 0.72
231 0.76
232 0.81
233 0.82
234 0.87
235 0.88