Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XCK9

Protein Details
Accession A0A317XCK9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29GNEGGGVRRRGKKRREEEEGGRGGBasic
120-139AQAVERKKPREGKKMRECESBasic
NLS Segment(s)
PositionSequence
7-34NEGGGVRRRGKKRREEEEGGRGGGGGRR
126-133KKPREGKK
Subcellular Location(s) mito 14, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MRPKGGNEGGGVRRRGKKRREEEEGGRGGGGGRRSGDRMLLWWWWCGGAEGRNSNSSNSRCRGALVDSCRGTGRGIRSIATGCQVSQSIMLKPLGKRETKWPVAMTAQTLVLVAGNPTVAQAVERKKPREGKKMRECESPCCLFFLLLRSLPPGIKPFLSFRQAVTGRNAHQPHSVSPKWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.68
4 0.71
5 0.75
6 0.81
7 0.83
8 0.82
9 0.81
10 0.81
11 0.75
12 0.65
13 0.54
14 0.45
15 0.36
16 0.31
17 0.24
18 0.16
19 0.14
20 0.15
21 0.17
22 0.18
23 0.18
24 0.16
25 0.16
26 0.17
27 0.2
28 0.2
29 0.18
30 0.18
31 0.16
32 0.16
33 0.15
34 0.15
35 0.14
36 0.17
37 0.2
38 0.22
39 0.26
40 0.27
41 0.27
42 0.31
43 0.31
44 0.32
45 0.31
46 0.31
47 0.27
48 0.27
49 0.27
50 0.24
51 0.27
52 0.26
53 0.3
54 0.29
55 0.29
56 0.29
57 0.27
58 0.24
59 0.21
60 0.2
61 0.18
62 0.18
63 0.18
64 0.18
65 0.19
66 0.19
67 0.17
68 0.14
69 0.09
70 0.09
71 0.09
72 0.08
73 0.1
74 0.1
75 0.09
76 0.1
77 0.12
78 0.13
79 0.13
80 0.2
81 0.22
82 0.22
83 0.23
84 0.29
85 0.37
86 0.37
87 0.39
88 0.33
89 0.31
90 0.31
91 0.31
92 0.24
93 0.16
94 0.13
95 0.11
96 0.1
97 0.08
98 0.06
99 0.06
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.04
106 0.03
107 0.04
108 0.09
109 0.14
110 0.21
111 0.27
112 0.3
113 0.37
114 0.46
115 0.55
116 0.61
117 0.65
118 0.69
119 0.74
120 0.82
121 0.79
122 0.79
123 0.74
124 0.69
125 0.67
126 0.6
127 0.5
128 0.42
129 0.38
130 0.29
131 0.27
132 0.25
133 0.22
134 0.19
135 0.19
136 0.19
137 0.2
138 0.2
139 0.21
140 0.2
141 0.19
142 0.19
143 0.21
144 0.24
145 0.29
146 0.33
147 0.31
148 0.29
149 0.36
150 0.37
151 0.37
152 0.38
153 0.38
154 0.37
155 0.45
156 0.46
157 0.39
158 0.42
159 0.43
160 0.42
161 0.46