Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VDH7

Protein Details
Accession A0A317VDH7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
235-255KPFASLRKALSLRRRKRRGTSHydrophilic
NLS Segment(s)
PositionSequence
75-91RRRKQSPASQHGPRRHR
241-254RKALSLRRRKRRGT
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MASSVLPACATSHQPSFSRYPPNLMDMDVEMDSFAPYQRFLAHSPSQRALNRQRSTSFPSVYYSGSPEHHPVEPRRRKQSPASQHGPRRHRHDSPSRPQQTKFSRHSMLVNPDVIDRLDSASLYQYHHEGPYDAVYPERNYHTKQSPVEAVKGSTAEALKATPKDKIRDCIDSHRPLDGVAFYPPGHTDMEGRTYEYEEGTNMMNDYGNFMRCPGQKFTDEDFKNDPFYNMPHPKPFASLRKALSLRRRKRRGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.36
4 0.39
5 0.44
6 0.4
7 0.43
8 0.42
9 0.44
10 0.41
11 0.36
12 0.32
13 0.23
14 0.25
15 0.19
16 0.16
17 0.12
18 0.11
19 0.11
20 0.1
21 0.1
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.15
28 0.22
29 0.27
30 0.34
31 0.39
32 0.41
33 0.46
34 0.46
35 0.53
36 0.55
37 0.59
38 0.55
39 0.54
40 0.54
41 0.51
42 0.57
43 0.55
44 0.47
45 0.37
46 0.37
47 0.35
48 0.33
49 0.29
50 0.24
51 0.2
52 0.19
53 0.2
54 0.2
55 0.21
56 0.22
57 0.27
58 0.33
59 0.41
60 0.5
61 0.56
62 0.62
63 0.63
64 0.65
65 0.69
66 0.72
67 0.71
68 0.7
69 0.7
70 0.69
71 0.73
72 0.77
73 0.75
74 0.71
75 0.69
76 0.67
77 0.65
78 0.65
79 0.68
80 0.69
81 0.71
82 0.76
83 0.76
84 0.72
85 0.68
86 0.69
87 0.66
88 0.65
89 0.6
90 0.56
91 0.5
92 0.48
93 0.5
94 0.45
95 0.42
96 0.36
97 0.31
98 0.25
99 0.23
100 0.22
101 0.18
102 0.14
103 0.09
104 0.07
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.08
111 0.09
112 0.09
113 0.09
114 0.1
115 0.1
116 0.08
117 0.08
118 0.09
119 0.1
120 0.09
121 0.08
122 0.09
123 0.1
124 0.12
125 0.15
126 0.16
127 0.16
128 0.22
129 0.25
130 0.3
131 0.29
132 0.3
133 0.33
134 0.32
135 0.33
136 0.28
137 0.25
138 0.2
139 0.19
140 0.16
141 0.12
142 0.11
143 0.08
144 0.08
145 0.08
146 0.1
147 0.12
148 0.13
149 0.16
150 0.2
151 0.26
152 0.29
153 0.35
154 0.37
155 0.41
156 0.43
157 0.47
158 0.51
159 0.52
160 0.5
161 0.45
162 0.4
163 0.34
164 0.32
165 0.24
166 0.17
167 0.11
168 0.12
169 0.11
170 0.11
171 0.12
172 0.12
173 0.11
174 0.11
175 0.11
176 0.11
177 0.16
178 0.16
179 0.17
180 0.16
181 0.18
182 0.18
183 0.17
184 0.15
185 0.11
186 0.11
187 0.11
188 0.1
189 0.09
190 0.09
191 0.09
192 0.08
193 0.12
194 0.13
195 0.14
196 0.13
197 0.14
198 0.21
199 0.23
200 0.28
201 0.29
202 0.31
203 0.33
204 0.39
205 0.43
206 0.47
207 0.45
208 0.45
209 0.45
210 0.43
211 0.44
212 0.39
213 0.35
214 0.26
215 0.29
216 0.35
217 0.38
218 0.41
219 0.43
220 0.46
221 0.45
222 0.49
223 0.53
224 0.52
225 0.51
226 0.53
227 0.49
228 0.55
229 0.59
230 0.62
231 0.64
232 0.66
233 0.7
234 0.74
235 0.81