Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317W2U4

Protein Details
Accession A0A317W2U4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-78EKPPDKVRPLGRRWSKHKNSLFQHBasic
NLS Segment(s)
PositionSequence
57-70PPDKVRPLGRRWSK
Subcellular Location(s) mito 14, extr 5, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MTLTSMLSTQNASSCRAINSCFSCLVFAPRNLGIIKARGVSCWGSMLQVRILGREKPPDKVRPLGRRWSKHKNSLFQHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.22
5 0.24
6 0.26
7 0.25
8 0.24
9 0.23
10 0.21
11 0.2
12 0.25
13 0.22
14 0.19
15 0.2
16 0.19
17 0.21
18 0.2
19 0.21
20 0.16
21 0.14
22 0.15
23 0.14
24 0.14
25 0.12
26 0.14
27 0.13
28 0.12
29 0.11
30 0.1
31 0.09
32 0.1
33 0.11
34 0.09
35 0.11
36 0.11
37 0.13
38 0.15
39 0.16
40 0.18
41 0.27
42 0.28
43 0.33
44 0.4
45 0.44
46 0.46
47 0.53
48 0.6
49 0.6
50 0.65
51 0.68
52 0.71
53 0.74
54 0.78
55 0.81
56 0.8
57 0.81
58 0.83
59 0.82