Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WQH4

Protein Details
Accession A0A317WQH4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-82GETNLATTRTRRRRRRSPTFYYVEKHydrophilic
NLS Segment(s)
PositionSequence
68-72RRRRR
Subcellular Location(s) mito 7extr 7, cyto 5, plas 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPMLLNNLLARNDADCPNTISGGGIAGIVLGTIAGTLLILWLFRLCSMGSGGDSDYGETNLATTRTRRRRRRSPTFYYVEKPRGEVRTPAKVYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.19
5 0.19
6 0.19
7 0.17
8 0.14
9 0.12
10 0.11
11 0.09
12 0.06
13 0.04
14 0.04
15 0.04
16 0.03
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.11
52 0.22
53 0.32
54 0.43
55 0.53
56 0.62
57 0.72
58 0.81
59 0.89
60 0.88
61 0.87
62 0.87
63 0.83
64 0.79
65 0.75
66 0.73
67 0.68
68 0.6
69 0.54
70 0.51
71 0.49
72 0.46
73 0.48
74 0.46
75 0.5