Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VYH8

Protein Details
Accession A0A317VYH8   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-44QLDLKKVKTPEEPSRKKRKKFRESPPSTHRMSBasic
NLS Segment(s)
PositionSequence
20-36KTPEEPSRKKRKKFRES
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MKVEKQHYQSQMQLDLKKVKTPEEPSRKKRKKFRESPPSTHRMSLRSSPKITMVKVPPPEIVMIIMDLLDAPQDMDTLLKVFPRWKQNVPETYWRHRFIKDLMLEDEELPGLDDLDWKHVYLEMDLADNSLLGFGYPATDCKAYGENENDLFRSPGKDKIDLSHVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.48
4 0.48
5 0.45
6 0.41
7 0.42
8 0.48
9 0.53
10 0.56
11 0.65
12 0.7
13 0.8
14 0.85
15 0.87
16 0.89
17 0.9
18 0.9
19 0.9
20 0.91
21 0.91
22 0.9
23 0.9
24 0.89
25 0.83
26 0.74
27 0.69
28 0.6
29 0.51
30 0.46
31 0.45
32 0.45
33 0.46
34 0.45
35 0.42
36 0.46
37 0.46
38 0.43
39 0.42
40 0.37
41 0.38
42 0.39
43 0.39
44 0.33
45 0.31
46 0.3
47 0.22
48 0.18
49 0.11
50 0.08
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.05
66 0.05
67 0.06
68 0.08
69 0.13
70 0.2
71 0.24
72 0.27
73 0.33
74 0.39
75 0.44
76 0.45
77 0.51
78 0.49
79 0.54
80 0.56
81 0.54
82 0.5
83 0.45
84 0.43
85 0.36
86 0.38
87 0.32
88 0.29
89 0.27
90 0.26
91 0.26
92 0.24
93 0.22
94 0.14
95 0.11
96 0.08
97 0.07
98 0.05
99 0.04
100 0.06
101 0.06
102 0.11
103 0.12
104 0.11
105 0.12
106 0.14
107 0.14
108 0.13
109 0.14
110 0.09
111 0.1
112 0.1
113 0.1
114 0.08
115 0.07
116 0.07
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.05
123 0.06
124 0.07
125 0.1
126 0.11
127 0.11
128 0.13
129 0.17
130 0.17
131 0.23
132 0.25
133 0.27
134 0.3
135 0.31
136 0.29
137 0.27
138 0.27
139 0.23
140 0.25
141 0.23
142 0.27
143 0.3
144 0.34
145 0.34
146 0.37