Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317UZM2

Protein Details
Accession A0A317UZM2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-51RWWMSSPSPRPRPRPRLRLRLRVGHydrophilic
NLS Segment(s)
PositionSequence
36-49PRPRPRPRLRLRLR
Subcellular Location(s) plas 8, mito 7, nucl 6, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMDTPRNLRPDLLNYQIYIRFRSDDRVRWWMSSPSPRPRPRPRLRLRLRVGLRLRLRWCAVGGFMWCGIVLMVSVCRLIGVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.37
4 0.34
5 0.3
6 0.25
7 0.22
8 0.21
9 0.29
10 0.31
11 0.34
12 0.38
13 0.43
14 0.43
15 0.42
16 0.44
17 0.4
18 0.4
19 0.42
20 0.43
21 0.46
22 0.54
23 0.58
24 0.65
25 0.71
26 0.77
27 0.77
28 0.81
29 0.8
30 0.81
31 0.83
32 0.84
33 0.78
34 0.77
35 0.7
36 0.68
37 0.62
38 0.6
39 0.56
40 0.52
41 0.5
42 0.45
43 0.44
44 0.36
45 0.33
46 0.25
47 0.23
48 0.18
49 0.17
50 0.14
51 0.13
52 0.12
53 0.1
54 0.1
55 0.09
56 0.06
57 0.05
58 0.04
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06