Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X642

Protein Details
Accession A0A317X642    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-125KRATYNPSRRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKSLSBasic
NLS Segment(s)
PositionSequence
90-123SRRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKS
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MADRPASNTRLSSAPLTPVATSLSTPFRTLSSTTLTSLRVSNQQQYIPSQSLTSSAIRPLLTTNPFTTQQTRSFSASASLAGKRATYNPSRRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.24
4 0.21
5 0.2
6 0.19
7 0.17
8 0.16
9 0.15
10 0.18
11 0.18
12 0.18
13 0.18
14 0.17
15 0.19
16 0.19
17 0.19
18 0.19
19 0.19
20 0.2
21 0.21
22 0.21
23 0.2
24 0.2
25 0.2
26 0.21
27 0.22
28 0.25
29 0.26
30 0.26
31 0.26
32 0.28
33 0.3
34 0.24
35 0.22
36 0.18
37 0.15
38 0.15
39 0.16
40 0.15
41 0.11
42 0.11
43 0.12
44 0.12
45 0.12
46 0.12
47 0.14
48 0.14
49 0.15
50 0.15
51 0.16
52 0.18
53 0.19
54 0.21
55 0.21
56 0.24
57 0.26
58 0.27
59 0.26
60 0.26
61 0.24
62 0.23
63 0.19
64 0.16
65 0.14
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.13
72 0.17
73 0.23
74 0.3
75 0.37
76 0.45
77 0.55
78 0.62
79 0.7
80 0.74
81 0.77
82 0.79
83 0.8
84 0.81
85 0.78
86 0.76
87 0.76
88 0.78
89 0.73
90 0.65
91 0.59
92 0.57
93 0.56
94 0.56
95 0.53
96 0.5
97 0.52
98 0.6
99 0.68
100 0.71
101 0.74
102 0.75
103 0.8
104 0.82
105 0.82
106 0.81