Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XBB3

Protein Details
Accession A0A317XBB3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDPKRVTDKRSRRFLPKKRYRYKSPVVDSPHydrophilic
NLS Segment(s)
PositionSequence
9-19KRSRRFLPKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPKRVTDKRSRRFLPKKRYRYKSPVVDSPASTTNLSPHHSKVLRNNIDGITRPTIRRLARRGGVVRISAAIYAEVRVVLKNRLTEILRHVVHVMDSSTTPRRERKVVTTRDVVFALNRMGHTLYGFDHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.89
5 0.89
6 0.91
7 0.9
8 0.88
9 0.88
10 0.87
11 0.82
12 0.79
13 0.75
14 0.69
15 0.61
16 0.55
17 0.48
18 0.4
19 0.34
20 0.26
21 0.23
22 0.22
23 0.24
24 0.22
25 0.21
26 0.27
27 0.28
28 0.31
29 0.36
30 0.44
31 0.45
32 0.44
33 0.45
34 0.38
35 0.38
36 0.36
37 0.31
38 0.24
39 0.22
40 0.22
41 0.21
42 0.26
43 0.27
44 0.32
45 0.32
46 0.34
47 0.35
48 0.4
49 0.4
50 0.37
51 0.36
52 0.3
53 0.26
54 0.2
55 0.17
56 0.12
57 0.1
58 0.07
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.07
66 0.09
67 0.11
68 0.12
69 0.13
70 0.16
71 0.17
72 0.18
73 0.21
74 0.27
75 0.25
76 0.25
77 0.24
78 0.21
79 0.2
80 0.19
81 0.15
82 0.08
83 0.09
84 0.13
85 0.18
86 0.21
87 0.24
88 0.29
89 0.33
90 0.38
91 0.42
92 0.48
93 0.53
94 0.58
95 0.6
96 0.62
97 0.59
98 0.57
99 0.53
100 0.43
101 0.34
102 0.28
103 0.25
104 0.2
105 0.18
106 0.17
107 0.17
108 0.16
109 0.16
110 0.15