Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WLE2

Protein Details
Accession A0A317WLE2   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTGGCAARRDRRRGCPQQPPYPHRVYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 4, nucl 3, cyto 2, extr 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTGGCAARRDRRRGCPQQPPYPHRVYTLRFTAVLPSPAVWQRRWRTRLCSGGMLTAPVRLRPLEGFKFPVYPPEVDAGVCCCCCVSVPSHWCLLFSCYIFGLASSLDCLSSMLSVSAYCKSLLSCLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.85
4 0.86
5 0.88
6 0.84
7 0.81
8 0.77
9 0.68
10 0.62
11 0.59
12 0.53
13 0.49
14 0.47
15 0.41
16 0.35
17 0.34
18 0.33
19 0.3
20 0.28
21 0.22
22 0.17
23 0.18
24 0.22
25 0.25
26 0.22
27 0.28
28 0.35
29 0.44
30 0.48
31 0.49
32 0.51
33 0.56
34 0.61
35 0.55
36 0.52
37 0.43
38 0.4
39 0.36
40 0.31
41 0.23
42 0.19
43 0.17
44 0.12
45 0.13
46 0.1
47 0.11
48 0.11
49 0.16
50 0.15
51 0.16
52 0.19
53 0.19
54 0.21
55 0.2
56 0.23
57 0.2
58 0.18
59 0.18
60 0.16
61 0.16
62 0.13
63 0.14
64 0.12
65 0.11
66 0.11
67 0.09
68 0.07
69 0.07
70 0.08
71 0.09
72 0.1
73 0.16
74 0.2
75 0.22
76 0.26
77 0.26
78 0.26
79 0.26
80 0.26
81 0.2
82 0.17
83 0.16
84 0.13
85 0.14
86 0.13
87 0.12
88 0.1
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.07
96 0.06
97 0.06
98 0.07
99 0.06
100 0.06
101 0.07
102 0.08
103 0.11
104 0.11
105 0.11
106 0.12
107 0.12