Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X5U7

Protein Details
Accession A0A317X5U7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
105-126GETDPRRHSHRRRSGRHSAASQBasic
140-166SWTSSQSSHGSRRRRRRRHASQNGSSTHydrophilic
NLS Segment(s)
PositionSequence
150-158SRRRRRRRH
Subcellular Location(s) nucl 17.5, mito_nucl 11, cyto 5, mito 3.5
Family & Domain DBs
Amino Acid Sequences MVRMYLPGVKEGEVGNVGLYVPQKGFWEQWFGFGSGKEDVPRVLGIDAEKKDESVGKEGNGEDKTKEQSEQQRGMPAEEYELSGEEYIYEEADDLDRASTVASAGETDPRRHSHRRRSGRHSAASQSGSYTGSDFFSVYSWTSSQSSHGSRRRRRRRHASQNGSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.11
4 0.1
5 0.1
6 0.11
7 0.1
8 0.09
9 0.1
10 0.12
11 0.14
12 0.16
13 0.16
14 0.23
15 0.22
16 0.26
17 0.27
18 0.26
19 0.25
20 0.24
21 0.25
22 0.18
23 0.19
24 0.16
25 0.14
26 0.13
27 0.14
28 0.13
29 0.12
30 0.1
31 0.1
32 0.1
33 0.16
34 0.17
35 0.19
36 0.19
37 0.18
38 0.19
39 0.21
40 0.21
41 0.19
42 0.19
43 0.16
44 0.18
45 0.18
46 0.23
47 0.21
48 0.2
49 0.16
50 0.18
51 0.2
52 0.19
53 0.2
54 0.2
55 0.28
56 0.34
57 0.36
58 0.35
59 0.37
60 0.36
61 0.37
62 0.32
63 0.23
64 0.18
65 0.14
66 0.14
67 0.08
68 0.08
69 0.08
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.11
93 0.13
94 0.15
95 0.18
96 0.22
97 0.28
98 0.36
99 0.45
100 0.5
101 0.6
102 0.68
103 0.74
104 0.79
105 0.84
106 0.83
107 0.8
108 0.73
109 0.67
110 0.62
111 0.55
112 0.46
113 0.37
114 0.29
115 0.24
116 0.2
117 0.16
118 0.11
119 0.1
120 0.11
121 0.1
122 0.09
123 0.09
124 0.1
125 0.1
126 0.11
127 0.1
128 0.13
129 0.14
130 0.14
131 0.17
132 0.22
133 0.27
134 0.34
135 0.42
136 0.49
137 0.59
138 0.7
139 0.78
140 0.83
141 0.88
142 0.9
143 0.93
144 0.94
145 0.96
146 0.95